![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Araha.26260s0002.1.p | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
|
||||||||
| Family | NF-YB | ||||||||
| Protein Properties | Length: 161aa MW: 18215.3 Da PI: 7.1948 | ||||||||
| Description | NF-YB family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NF-YB | 171.4 | 1e-53 | 50 | 145 | 2 | 97 |
NF-YB 2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkky 90
+eqdr+lPianv+rimk++lP nak+sk+aket+qecvsefisfvt+easdkc++ekrkt+ngdd++wa+a+lGf+dy+++lk+yl++y
Araha.26260s0002.1.p 50 KEQDRLLPIANVGRIMKNTLPPNAKVSKEAKETMQECVSEFISFVTGEASDKCHKEKRKTVNGDDICWAMANLGFDDYAAQLKKYLHRY 138
89*************************************************************************************** PP
NF-YB 91 relegek 97
r legek
Araha.26260s0002.1.p 139 RVLEGEK 145
****997 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:1.10.20.10 | 1.7E-52 | 42 | 155 | IPR009072 | Histone-fold |
| SuperFamily | SSF47113 | 2.64E-39 | 52 | 155 | IPR009072 | Histone-fold |
| Pfam | PF00808 | 6.7E-28 | 55 | 119 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
| PRINTS | PR00615 | 4.8E-18 | 83 | 101 | No hit | No description |
| PROSITE pattern | PS00685 | 0 | 86 | 102 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
| PRINTS | PR00615 | 4.8E-18 | 102 | 120 | No hit | No description |
| PRINTS | PR00615 | 4.8E-18 | 121 | 139 | No hit | No description |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| GO:0046982 | Molecular Function | protein heterodimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 161 aa Download sequence Send to blast |
MAGNYHSFQN PIPRYQNYNF SSSSSHHQHQ QDGLVVVVED QQQEENMMIK EQDRLLPIAN 60 VGRIMKNTLP PNAKVSKEAK ETMQECVSEF ISFVTGEASD KCHKEKRKTV NGDDICWAMA 120 NLGFDDYAAQ LKKYLHRYRV LEGEKPNQHA KGGSKSSPDN * |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 4g91_B | 5e-44 | 49 | 139 | 1 | 91 | Transcription factor HapC (Eurofung) |
| 4g92_B | 5e-44 | 49 | 139 | 1 | 91 | Transcription factor HapC (Eurofung) |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Araha.26260s0002.1.p |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AC005309 | 0.0 | AC005309.3 Arabidopsis thaliana chromosome 2 clone F17A22 map CIC06C03, complete sequence. | |||
| GenBank | BT003968 | 0.0 | BT003968.1 Arabidopsis thaliana clone RAFL15-27-K05 (R20859) putative CCAAT-box binding trancription factor (At2g47810) mRNA, complete cds. | |||
| GenBank | BT005081 | 0.0 | BT005081.1 Arabidopsis thaliana clone U20859 putative CCAAT-box binding trancription factor (At2g47810) mRNA, complete cds. | |||
| GenBank | CP002685 | 0.0 | CP002685.1 Arabidopsis thaliana chromosome 2, complete sequence. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | NP_182302.1 | 1e-111 | nuclear factor Y, subunit B5 | ||||
| Swissprot | O82248 | 1e-112 | NFYB5_ARATH; Nuclear transcription factor Y subunit B-5 | ||||
| TrEMBL | A0A178VUG0 | 1e-109 | A0A178VUG0_ARATH; NF-YB5 | ||||
| STRING | AT2G47810.1 | 1e-110 | (Arabidopsis thaliana) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM255 | 28 | 229 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT2G47810.1 | 1e-94 | nuclear factor Y, subunit B5 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | Araha.26260s0002.1.p |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




