![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Araha.43003s0010.1.p | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
|
||||||||
| Family | NAC | ||||||||
| Protein Properties | Length: 239aa MW: 26954.6 Da PI: 8.663 | ||||||||
| Description | NAC family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NAM | 176.3 | 8.4e-55 | 20 | 148 | 1 | 129 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkd 89
+ppGfrFhPtdeel+++yL kkv ++++++ +i++vd++k+ePw+Lp+k+k +ekewyfF+ rd+ky+tg r+nrat++gyWkatgkd
Araha.43003s0010.1.p 20 MPPGFRFHPTDEELITYYLLKKVLDSNFSC-AAISQVDLNKSEPWELPEKAKMGEKEWYFFTLRDRKYPTGLRTNRATEAGYWKATGKD 107
79****************************.88***************99999************************************ PP
NAM 90 kevlsk.kgelvglkktLvfykgrapkgektdWvmheyrle 129
+e++s+ +++l g+kktLvfykgrapkgek+ Wvmheyrle
Araha.43003s0010.1.p 108 REIKSSkTKSLLGMKKTLVFYKGRAPKGEKSCWVMHEYRLE 148
****9856677****************************85 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SuperFamily | SSF101941 | 3.79E-62 | 17 | 172 | IPR003441 | NAC domain |
| PROSITE profile | PS51005 | 58.666 | 20 | 172 | IPR003441 | NAC domain |
| Pfam | PF02365 | 6.3E-29 | 21 | 147 | IPR003441 | NAC domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0009793 | Biological Process | embryo development ending in seed dormancy | ||||
| GO:0010014 | Biological Process | meristem initiation | ||||
| GO:0010160 | Biological Process | formation of organ boundary | ||||
| GO:0010223 | Biological Process | secondary shoot formation | ||||
| GO:0048467 | Biological Process | gynoecium development | ||||
| GO:0051782 | Biological Process | negative regulation of cell division | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 239 aa Download sequence Send to blast |
MDVDVFNGWG RPRFEDETLM PPGFRFHPTD EELITYYLLK KVLDSNFSCA AISQVDLNKS 60 EPWELPEKAK MGEKEWYFFT LRDRKYPTGL RTNRATEAGY WKATGKDREI KSSKTKSLLG 120 MKKTLVFYKG RAPKGEKSCW VMHEYRLEGK FSYHYISSSA KDEWVLCKVC LKSGVVSRET 180 NLISSSSSAV AGEYSSAGSV IAPIINTFAT EHVSCFSNNS AAHADASFHT YLPAPPPSL |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1ut4_A | 8e-52 | 20 | 173 | 17 | 166 | NO APICAL MERISTEM PROTEIN |
| 1ut4_B | 8e-52 | 20 | 173 | 17 | 166 | NO APICAL MERISTEM PROTEIN |
| 1ut7_A | 8e-52 | 20 | 173 | 17 | 166 | NO APICAL MERISTEM PROTEIN |
| 1ut7_B | 8e-52 | 20 | 173 | 17 | 166 | NO APICAL MERISTEM PROTEIN |
| 3swm_A | 8e-52 | 20 | 173 | 20 | 169 | NAC domain-containing protein 19 |
| 3swm_B | 8e-52 | 20 | 173 | 20 | 169 | NAC domain-containing protein 19 |
| 3swm_C | 8e-52 | 20 | 173 | 20 | 169 | NAC domain-containing protein 19 |
| 3swm_D | 8e-52 | 20 | 173 | 20 | 169 | NAC domain-containing protein 19 |
| 3swp_A | 8e-52 | 20 | 173 | 20 | 169 | NAC domain-containing protein 19 |
| 3swp_B | 8e-52 | 20 | 173 | 20 | 169 | NAC domain-containing protein 19 |
| 3swp_C | 8e-52 | 20 | 173 | 20 | 169 | NAC domain-containing protein 19 |
| 3swp_D | 8e-52 | 20 | 173 | 20 | 169 | NAC domain-containing protein 19 |
| 4dul_A | 8e-52 | 20 | 173 | 17 | 166 | NAC domain-containing protein 19 |
| 4dul_B | 8e-52 | 20 | 173 | 17 | 166 | NAC domain-containing protein 19 |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription activator of STM and KNAT6. Involved in molecular mechanisms regulating shoot apical meristem (SAM) formation during embryogenesis and organ separation. Required for the fusion of septa of gynoecia along the length of the ovaries. Activates the shoot formation in callus in a STM-dependent manner. Seems to act as an inhibitor of cell division. {ECO:0000269|PubMed:10079219, ECO:0000269|PubMed:10750709, ECO:0000269|PubMed:11245578, ECO:0000269|PubMed:12163400, ECO:0000269|PubMed:12492830, ECO:0000269|PubMed:12610213, ECO:0000269|PubMed:12787253, ECO:0000269|PubMed:14617069, ECO:0000269|PubMed:15202996, ECO:0000269|PubMed:15294871, ECO:0000269|PubMed:15500463, ECO:0000269|PubMed:15723790, ECO:0000269|PubMed:16798887, ECO:0000269|PubMed:17122068, ECO:0000269|PubMed:17287247, ECO:0000269|PubMed:9212461}. | |||||
| Binding Motif ? help Back to Top | |||
|---|---|---|---|
| Motif ID | Method | Source | Motif file |
| MP00357 | DAP | Transfer from AT3G15170 | Download |
| |||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Araha.43003s0010.1.p |
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: By BRM, at the chromatin level, and conferring a very specific spatial expression pattern. Directly induced by ESR2 in response to cytokinins. Precise spatial regulation by post-transcriptional repression directed by the microRNA miR164. {ECO:0000269|PubMed:15202996, ECO:0000269|PubMed:15294871, ECO:0000269|PubMed:15723790, ECO:0000269|PubMed:16854978, ECO:0000269|PubMed:17056621, ECO:0000269|PubMed:17287247}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | Retrieve | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AB049069 | 0.0 | AB049069.1 Arabidopsis thaliana CUC1 mRNA, complete cds. | |||
| GenBank | BT026080 | 0.0 | BT026080.1 Arabidopsis thaliana At3g15170 mRNA, complete cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_002882916.1 | 1e-164 | protein CUP-SHAPED COTYLEDON 1 | ||||
| Swissprot | Q9FRV4 | 1e-163 | NAC54_ARATH; Protein CUP-SHAPED COTYLEDON 1 | ||||
| TrEMBL | D7L3Z7 | 1e-163 | D7L3Z7_ARALL; Cup-shaped cotyledon1 | ||||
| STRING | fgenesh2_kg.3__1650__AT3G15170.1 | 1e-164 | (Arabidopsis lyrata) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM13481 | 15 | 28 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT3G15170.1 | 1e-157 | NAC family protein | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | Araha.43003s0010.1.p |




