![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Araha.5497s0002.1.p | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
|
||||||||
| Family | M-type_MADS | ||||||||
| Protein Properties | Length: 73aa MW: 8128.46 Da PI: 10.2635 | ||||||||
| Description | M-type_MADS family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | SRF-TF | 54.3 | 1.7e-17 | 15 | 64 | 1 | 50 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS
SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50
k+ie + r vt+skRrngi K +ELS+LC+aeva + +s +gk y++
Araha.5497s0002.1.p 15 KKIEKDEDRLVTLSKRRNGIYTKLSELSILCGAEVAFLGYSCSGKPYTFG 64
689*********************************************95 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SuperFamily | SSF55455 | 1.44E-21 | 7 | 72 | IPR002100 | Transcription factor, MADS-box |
| SMART | SM00432 | 3.1E-19 | 7 | 66 | IPR002100 | Transcription factor, MADS-box |
| PROSITE profile | PS50066 | 21.698 | 7 | 67 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 1.9E-15 | 9 | 29 | IPR002100 | Transcription factor, MADS-box |
| Pfam | PF00319 | 9.5E-20 | 16 | 63 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 1.9E-15 | 29 | 44 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 1.9E-15 | 44 | 65 | IPR002100 | Transcription factor, MADS-box |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| GO:0046983 | Molecular Function | protein dimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 73 aa Download sequence Send to blast |
MNPKKTKGKQ RITIKKIEKD EDRLVTLSKR RNGIYTKLSE LSILCGAEVA FLGYSCSGKP 60 YTFGSPSFQA VAE |
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Araha.5497s0002.1.p |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AC022455 | 2e-90 | AC022455.5 Arabidopsis thaliana chromosome 1 BAC T1P2 genomic sequence, complete sequence. | |||
| GenBank | AY141244 | 2e-90 | AY141244.1 Arabidopsis thaliana MADS-box protein AGL64 mRNA, complete cds. | |||
| GenBank | CP002684 | 2e-90 | CP002684.1 Arabidopsis thaliana chromosome 1 sequence. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_020867367.1 | 1e-46 | agamous-like MADS-box protein AGL29 | ||||
| Refseq | XP_020867368.1 | 1e-46 | agamous-like MADS-box protein AGL29 | ||||
| TrEMBL | D7KEP0 | 1e-44 | D7KEP0_ARALL; Uncharacterized protein | ||||
| STRING | fgenesh1_pg.C_scaffold_1002660 | 2e-45 | (Arabidopsis lyrata) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM86 | 28 | 390 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G29962.1 | 5e-49 | AGAMOUS-like 64 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | Araha.5497s0002.1.p |




