![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Araha.71473s0001.1.p | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
|
||||||||
| Family | M-type_MADS | ||||||||
| Protein Properties | Length: 91aa MW: 10704.7 Da PI: 9.7603 | ||||||||
| Description | M-type_MADS family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | SRF-TF | 55.3 | 8.3e-18 | 7 | 50 | 2 | 45 |
---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSE CS
SRF-TF 2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgk 45
rie+ r+ +skR++g++KKAeE+ LCd e+ +i++s+t+k
Araha.71473s0001.1.p 7 RIESLKERSSKYSKRKKGLFKKAEEVALLCDCEIILIVVSPTDK 50
89***************************************987 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS50066 | 18.909 | 1 | 58 | IPR002100 | Transcription factor, MADS-box |
| SuperFamily | SSF55455 | 4.58E-21 | 2 | 76 | IPR002100 | Transcription factor, MADS-box |
| CDD | cd00266 | 4.17E-20 | 2 | 81 | No hit | No description |
| SMART | SM00432 | 1.1E-18 | 2 | 57 | IPR002100 | Transcription factor, MADS-box |
| Pfam | PF00319 | 3.9E-17 | 7 | 53 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 5.4E-8 | 20 | 35 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 5.4E-8 | 35 | 56 | IPR002100 | Transcription factor, MADS-box |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| GO:0046983 | Molecular Function | protein dimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 91 aa Download sequence Send to blast |
MKIKLNRIES LKERSSKYSK RKKGLFKKAE EVALLCDCEI ILIVVSPTDK PTLFHTRSKS 60 FSKIYERYCM LSLQEREERC DLSDLYIIIR * |
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Araha.71473s0001.1.p |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_020884452.1 | 3e-47 | agamous-like MADS-box protein AGL66 | ||||
| TrEMBL | D7LDF5 | 1e-53 | D7LDF5_ARALL; Uncharacterized protein | ||||
| STRING | fgenesh1_pm.C_scaffold_4000481 | 2e-54 | (Arabidopsis lyrata) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM7330 | 18 | 38 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT2G26320.1 | 2e-36 | AGAMOUS-like 33 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | Araha.71473s0001.1.p |




