![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Araha.8092s0001.1.p | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
|
||||||||
| Family | MIKC_MADS | ||||||||
| Protein Properties | Length: 188aa MW: 21142.4 Da PI: 9.7182 | ||||||||
| Description | MIKC_MADS family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | SRF-TF | 67.4 | 1.4e-21 | 9 | 56 | 1 | 48 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEE CS
SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklye 48
krienks rqvtfskRrng++ KA LSvLC+ +av+++s +gkly+
Araha.8092s0001.1.p 9 KRIENKSSRQVTFSKRRNGLIGKARQLSVLCESSIAVLVVSGSGKLYT 56
79*********************************************9 PP
| |||||||
| 2 | K-box | 35.6 | 3.9e-13 | 102 | 152 | 47 | 97 |
K-box 47 slkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkk 97
s+ L ++e+qLe++l+ iR+kK+el++e+++ lq+ e l+een+ L +
Araha.8092s0001.1.p 102 SVDSLISMEEQLETALSVIRAKKSELMMEEVKSLQETEMLLREENQILASH 152
56789*****************************************99865 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS50066 | 27.614 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
| SuperFamily | SSF55455 | 5.89E-25 | 1 | 71 | IPR002100 | Transcription factor, MADS-box |
| SMART | SM00432 | 1.3E-31 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 9.1E-23 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
| Pfam | PF00319 | 4.8E-21 | 10 | 56 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 9.1E-23 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 9.1E-23 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
| PROSITE profile | PS51297 | 10.384 | 66 | 161 | IPR002487 | Transcription factor, K-box |
| Pfam | PF01486 | 2.0E-9 | 102 | 151 | IPR002487 | Transcription factor, K-box |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0009910 | Biological Process | negative regulation of flower development | ||||
| GO:0010048 | Biological Process | vernalization response | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0046983 | Molecular Function | protein dimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 188 aa Download sequence Send to blast |
MGRRKVEIKR IENKSSRQVT FSKRRNGLIG KARQLSVLCE SSIAVLVVSG SGKLYTSASG 60 DNISKIIDRY EIQRADELKA LDLAEKIRNY LPHKELLEIV QSVDSLISME EQLETALSVI 120 RAKKSELMME EVKSLQETEM LLREENQILA SHTQLGKNTF LVTEGERRMS RENGSGNKVP 180 ETLPLLK* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 6byy_A | 1e-15 | 1 | 70 | 1 | 69 | MEF2 CHIMERA |
| 6byy_B | 1e-15 | 1 | 70 | 1 | 69 | MEF2 CHIMERA |
| 6byy_C | 1e-15 | 1 | 70 | 1 | 69 | MEF2 CHIMERA |
| 6byy_D | 1e-15 | 1 | 70 | 1 | 69 | MEF2 CHIMERA |
| 6bz1_A | 1e-15 | 1 | 70 | 1 | 69 | MEF2 CHIMERA |
| 6bz1_B | 1e-15 | 1 | 70 | 1 | 69 | MEF2 CHIMERA |
| 6bz1_C | 1e-15 | 1 | 70 | 1 | 69 | MEF2 CHIMERA |
| 6bz1_D | 1e-15 | 1 | 70 | 1 | 69 | MEF2 CHIMERA |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Probable transcription factor involved in the negative regulation of flowering time, probably through the photoperiodic and vernalization pathways; more efficient in cv. Landsberg erecta than in cv. Columbia background. Prevents premature flowering (PubMed:12724541, PubMed:25339407). Involved in the modulation of vernalization impact on flowering according to genotype acclimation to altitude (PubMed:25339407). {ECO:0000269|PubMed:12724541, ECO:0000269|PubMed:25339407}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Araha.8092s0001.1.p |
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Repressed during vernalization (PubMed:12724541). Regulated by HAM1 and HAM2 via epigenetic modification of chromatins at H4K5 acetylation during flowering (PubMed:23273925). {ECO:0000269|PubMed:12724541, ECO:0000269|PubMed:23273925}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AY231446 | 0.0 | AY231446.1 Arabidopsis thaliana MADS affecting flowering 3 variant II (MAF3) mRNA, complete cds. | |||
| GenBank | BT025758 | 0.0 | BT025758.1 Arabidopsis thaliana At5g65060 mRNA, complete cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_020872032.1 | 1e-119 | agamous-like MADS-box protein AGL31 isoform X2 | ||||
| Swissprot | Q9LSR7 | 1e-107 | AGL70_ARATH; Agamous-like MADS-box protein AGL70 | ||||
| TrEMBL | D7MWX9 | 1e-114 | D7MWX9_ARALL; Uncharacterized protein | ||||
| STRING | fgenesh2_kg.233__4__AT5G65050.3 | 1e-115 | (Arabidopsis lyrata) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM986 | 19 | 87 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G65060.2 | 1e-113 | MIKC_MADS family protein | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | Araha.8092s0001.1.p |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




