![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Araip.1I15S | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
|
||||||||
| Family | YABBY | ||||||||
| Protein Properties | Length: 70aa MW: 7638.76 Da PI: 3.8834 | ||||||||
| Description | YABBY family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | YABBY | 80.2 | 6.1e-25 | 6 | 64 | 3 | 61 |
YABBY 3 vfssseqvCyvqCnfCntilavsvPstslfkvvtvrCGhCtsllsvnlakasqllaaes 61
++ +eq+Cy+ CnfCn +lavsvP +slf +vtvrCGhCt+l svn+a a q l+ ++
Araip.1I15S 6 MDAGPEQLCYIPCNFCNIVLAVSVPCSSLFDMVTVRCGHCTNLWSVNMAAAFQSLSWQD 64
56679********************************************9999988776 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Pfam | PF04690 | 2.5E-26 | 10 | 66 | IPR006780 | YABBY protein |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0007275 | Biological Process | multicellular organism development | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 70 aa Download sequence Send to blast |
MSSCSMDAGP EQLCYIPCNF CNIVLAVSVP CSSLFDMVTV RCGHCTNLWS VNMAAAFQSL 60 SWQDLQDPNS |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Promotes adaxial cell identity. Regulates the initiation of embryonic shoot apical meristem (SAM) development. {ECO:0000269|PubMed:19837869}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Araip.1I15S |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_025673956.1 | 1e-43 | axial regulator YABBY 5 isoform X1 | ||||
| Swissprot | Q8GW46 | 1e-30 | YAB5_ARATH; Axial regulator YABBY 5 | ||||
| TrEMBL | A0A444Y3J4 | 4e-42 | A0A444Y3J4_ARAHY; Uncharacterized protein | ||||
| TrEMBL | A0A445AW85 | 4e-42 | A0A445AW85_ARAHY; Uncharacterized protein | ||||
| STRING | GLYMA17G12200.1 | 2e-39 | (Glycine max) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF1124 | 34 | 112 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT2G26580.2 | 6e-33 | YABBY family protein | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




