![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Araip.4R4C1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
|
||||||||
| Family | NAC | ||||||||
| Protein Properties | Length: 69aa MW: 7757.93 Da PI: 4.3287 | ||||||||
| Description | NAC family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NAM | 32.9 | 1.9e-10 | 25 | 54 | 1 | 30 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkklel 30
lp GfrF+Ptdeelv++yL++k++g+ e
Araip.4R4C1 25 LPLGFRFRPTDEELVDFYLRQKINGNGDEW 54
699*********************998554 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SuperFamily | SSF101941 | 8.76E-11 | 18 | 54 | IPR003441 | NAC domain |
| PROSITE profile | PS51005 | 13.421 | 25 | 69 | IPR003441 | NAC domain |
| Pfam | PF02365 | 1.5E-7 | 26 | 50 | IPR003441 | NAC domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 69 aa Download sequence Send to blast |
MGAVEVFQQQ PLVVDAAPVL SLNSLPLGFR FRPTDEELVD FYLRQKINGN GDEWKGDFKV 60 FLVYAVGIV |
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Araip.4R4C1 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_025609826.1 | 3e-30 | protein NTM1-like 9 isoform X2 | ||||
| TrEMBL | A0A444YAM6 | 9e-29 | A0A444YAM6_ARAHY; Uncharacterized protein | ||||
| STRING | AES72664 | 2e-16 | (Medicago truncatula) | ||||
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT3G49530.1 | 6e-14 | NAC domain containing protein 62 | ||||




