PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Araip.53XXU

Organism

Arachis ipaensis

Taxonomic ID

130454

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis

Family

MIKC_MADS

Protein Properties

Length: 220aa MW: 25405.2 Da PI: 8.8007

Description

MIKC_MADS family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Araip.53XXU	genome	NCGR_PGC	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SRF-TF	91.8	3.4e-29	31	81	1	51
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 krien + rqvtfskRr g+lKKA+ELSvLCda++a+iifs++g+l+eyss Araip.53XXU 31 KRIENATSRQVTFSKRRSGLLKKAHELSVLCDAQIALIIFSQSGRLFEYSS 81 79***********************************************96 PP
2	K-box	44.3	7.7e-16	115	174	21	80
K-box 21 lakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieel 80 L k+ie L+ +qR+l+G++L+s+s+ eL +e+qL +sl++iR kK++ ll + +l Araip.53XXU 115 PPSLAKKIELLELSQRKLMGQGLSSCSFDELVGIENQLVSSLQNIRLKKEKDLLLENAKL 174 55799********************************************98666554443 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SMART	SM00432	3.3E-41	23	82	IPR002100	Transcription factor, MADS-box
PROSITE profile	PS50066	32.015	23	83	IPR002100	Transcription factor, MADS-box
PROSITE pattern	PS00350	0	25	79	IPR002100	Transcription factor, MADS-box
SuperFamily	SSF55455	2.75E-32	25	100	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	1.7E-30	25	45	IPR002100	Transcription factor, MADS-box
CDD	cd00265	2.12E-42	25	99	No hit	No description
Pfam	PF00319	2.1E-25	32	79	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	1.7E-30	45	60	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	1.7E-30	60	81	IPR002100	Transcription factor, MADS-box
PROSITE profile	PS51297	9.407	108	203	IPR002487	Transcription factor, K-box
Pfam	PF01486	1.3E-12	116	174	IPR002487	Transcription factor, K-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0046983	Molecular Function	protein dimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 220 aa Download sequence Send to blast
MGASTNFWYD TKSVIEEIKK KKMVRGKIEM KRIENATSRQ VTFSKRRSGL LKKAHELSVL 60 CDAQIALIIF SQSGRLFEYS STSDMEQMLE RYRQYVADDG RINNIGEFQQ LEFDPPSLAK 120 KIELLELSQR KLMGQGLSSC SFDELVGIEN QLVSSLQNIR LKKEKDLLLE NAKLTEMCVQ 180 RKKSEERWDK QRDTTLSPSP SNQSSVLVET ELFIGLPEWR

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1tqe_P	1e-21	23	95	1	72	Myocyte-specific enhancer factor 2B
1tqe_Q	1e-21	23	95	1	72	Myocyte-specific enhancer factor 2B
1tqe_R	1e-21	23	95	1	72	Myocyte-specific enhancer factor 2B
1tqe_S	1e-21	23	95	1	72	Myocyte-specific enhancer factor 2B
3kov_A	1e-21	25	95	2	71	Myocyte-specific enhancer factor 2A
3kov_B	1e-21	25	95	2	71	Myocyte-specific enhancer factor 2A
3kov_I	1e-21	25	95	2	71	Myocyte-specific enhancer factor 2A
3kov_J	1e-21	25	95	2	71	Myocyte-specific enhancer factor 2A
3p57_A	1e-21	25	95	2	71	Myocyte-specific enhancer factor 2A
3p57_B	1e-21	25	95	2	71	Myocyte-specific enhancer factor 2A
3p57_C	1e-21	25	95	2	71	Myocyte-specific enhancer factor 2A
3p57_D	1e-21	25	95	2	71	Myocyte-specific enhancer factor 2A
3p57_I	1e-21	25	95	2	71	Myocyte-specific enhancer factor 2A
3p57_J	1e-21	25	95	2	71	Myocyte-specific enhancer factor 2A
6c9l_A	1e-21	23	95	1	72	Myocyte-specific enhancer factor 2B
6c9l_B	1e-21	23	95	1	72	Myocyte-specific enhancer factor 2B
6c9l_C	1e-21	23	95	1	72	Myocyte-specific enhancer factor 2B
6c9l_D	1e-21	23	95	1	72	Myocyte-specific enhancer factor 2B
6c9l_E	1e-21	23	95	1	72	Myocyte-specific enhancer factor 2B
6c9l_F	1e-21	23	95	1	72	Myocyte-specific enhancer factor 2B
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	MADS-box transcription factor that acts with AGL71 and AGL72 in the control of flowering time. Promotes flowering at the shoot apical and axillary meristems. Seems to act through a gibberellin-dependent pathway. Interacts genetically with SOC1 and its expression is directly regulated by SOC1 (PubMed:21609362). Plays a role in controlling flower organ senescence and abscission by repressing ethylene responses and regulating the expression of BOP2 and IDA (PubMed:21689171). {ECO:0000269\|PubMed:21609362, ECO:0000269\|PubMed:21689171}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Araip.53XXU

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_025656705.1	1e-139	MADS-box protein AGL42
Refseq	XP_029149012.1	1e-139	MADS-box protein AGL42
Refseq	XP_029149013.1	1e-139	MADS-box protein AGL42
Swissprot	Q9FIS1	6e-56	AGL42_ARATH; MADS-box protein AGL42
TrEMBL	A0A445CZV5	1e-111	A0A445CZV5_ARAHY; Uncharacterized protein
STRING	GLYMA10G38541.1	1e-64	(Glycine max)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF666	30	102

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G62165.4	4e-62	AGAMOUS-like 42