![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Araip.5KR1P | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
|
||||||||
| Family | WRKY | ||||||||
| Protein Properties | Length: 96aa MW: 10858.8 Da PI: 9.6172 | ||||||||
| Description | WRKY family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | WRKY | 93.8 | 1.3e-29 | 1 | 59 | 1 | 59 |
---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
WRKY 1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59
+dDg++WrKYG+K+vk+s++pr+YY+C+s gC vkk+ver+aed ++v + Y g Hnh+
Araip.5KR1P 1 MDDGFKWRKYGKKSVKNSPNPRNYYKCSSVGCGVKKRVERDAEDRSYVLTSYDGVHNHQ 59
69********************************************************8 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SMART | SM00774 | 2.5E-31 | 1 | 60 | IPR003657 | WRKY domain |
| Gene3D | G3DSA:2.20.25.80 | 8.1E-28 | 1 | 61 | IPR003657 | WRKY domain |
| PROSITE profile | PS50811 | 28.415 | 1 | 61 | IPR003657 | WRKY domain |
| SuperFamily | SSF118290 | 1.7E-25 | 1 | 61 | IPR003657 | WRKY domain |
| Pfam | PF03106 | 5.9E-23 | 2 | 59 | IPR003657 | WRKY domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 96 aa Download sequence Send to blast |
MDDGFKWRKY GKKSVKNSPN PRNYYKCSSV GCGVKKRVER DAEDRSYVLT SYDGVHNHQS 60 PSSNSYYTTS PFSIFHSNDI NWSLHAPAVN SSSSNS |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1wj2_A | 6e-23 | 1 | 62 | 17 | 78 | Probable WRKY transcription factor 4 |
| 2lex_A | 6e-23 | 1 | 62 | 17 | 78 | Probable WRKY transcription factor 4 |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). Involved in defense responses. May act as positive regulator of salicylic acid (SA)-mediated signaling and negative regulator of jasmonic acid (JA)-mediated signaling (PubMed:21030507). {ECO:0000250, ECO:0000269|PubMed:21030507}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Araip.5KR1P |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_025685309.1 | 9e-66 | probable WRKY transcription factor 51 | ||||
| Swissprot | Q93WU9 | 5e-32 | WRK51_ARATH; Probable WRKY transcription factor 51 | ||||
| TrEMBL | A0A444X513 | 1e-63 | A0A444X513_ARAHY; Uncharacterized protein | ||||
| STRING | XP_004502873.1 | 5e-37 | (Cicer arietinum) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF1120 | 34 | 110 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G64810.1 | 4e-31 | WRKY DNA-binding protein 51 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




