![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Araip.9UC54 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
|
||||||||
| Family | Whirly | ||||||||
| Protein Properties | Length: 106aa MW: 11795.5 Da PI: 8.2279 | ||||||||
| Description | Whirly family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Whirly | 72 | 9.8e-23 | 28 | 90 | 22 | 85 |
Whirly 22 dsgnlklkraGglllelanataerkydWekkqsfalsatevaelvdlaskesceffhdpaakgs 85
++++k++ +G +ll++a+++a r+ydW +kq+f+ls e+++++ l+++esceffhd +++s
Araip.9UC54 28 SGQAFKISIEGYVLLQFAPTVASRQYDWTRKQVFSLSMGEMGTVI-LGARESCEFFHDRIKGKS 90
47889*************************************988.9************99987 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Pfam | PF08536 | 6.5E-21 | 25 | 90 | IPR013742 | Plant transcription factor |
| SuperFamily | SSF54447 | 8.63E-16 | 28 | 94 | IPR009044 | ssDNA-binding transcriptional regulator |
| Gene3D | G3DSA:2.30.31.10 | 5.0E-19 | 29 | 90 | IPR009044 | ssDNA-binding transcriptional regulator |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 106 aa Download sequence Send to blast |
MFKNILSTCL AHVPFTKPLL AASWFFSSGQ AFKISIEGYV LLQFAPTVAS RQYDWTRKQV 60 FSLSMGEMGT VILGARESCE FFHDRIKGKS ISSDFGEESG GSDRTI |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 4koo_A | 2e-23 | 31 | 90 | 38 | 98 | Single-stranded DNA-binding protein WHY1, chloroplastic |
| 4koo_B | 2e-23 | 31 | 90 | 38 | 98 | Single-stranded DNA-binding protein WHY1, chloroplastic |
| 4koo_C | 2e-23 | 31 | 90 | 38 | 98 | Single-stranded DNA-binding protein WHY1, chloroplastic |
| 4koo_D | 2e-23 | 31 | 90 | 38 | 98 | Single-stranded DNA-binding protein WHY1, chloroplastic |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Single-stranded DNA and RNA binding protein that maintains plastid genome stability by preventing break-induced and short homology-dependent illegitimate recombinations. Functions in RNA metabolism and is involved in the maturation of the atpF and 23S ribosomal RNAs. {ECO:0000269|PubMed:18676978, ECO:0000269|PubMed:19666500}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Araip.9UC54 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_016190967.1 | 1e-29 | single-stranded DNA-binding protein WHY1, chloroplastic isoform X1 | ||||
| Refseq | XP_016190968.1 | 1e-29 | single-stranded DNA-binding protein WHY1, chloroplastic isoform X2 | ||||
| Refseq | XP_025639006.1 | 1e-29 | single-stranded DNA-binding protein WHY1, chloroplastic | ||||
| Swissprot | B2LXS7 | 2e-23 | WHY1_MAIZE; Single-stranded DNA-binding protein WHY1, chloroplastic | ||||
| TrEMBL | A0A445DP24 | 3e-28 | A0A445DP24_ARAHY; Uncharacterized protein | ||||
| STRING | GLYMA18G16200.1 | 5e-25 | (Glycine max) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF6416 | 32 | 51 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G14410.1 | 1e-24 | ssDNA-binding transcriptional regulator | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




