![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Araip.D7N1Q | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
|
||||||||
| Family | NAC | ||||||||
| Protein Properties | Length: 142aa MW: 16127.6 Da PI: 10.3197 | ||||||||
| Description | NAC family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NAM | 131.8 | 5e-41 | 11 | 121 | 1 | 128 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk.kg 97
lppGfrFhP+deel+v+yL++kv++++l++ ++i+e+d+yk++Pw+Lp +ky++g r+nra+ +gyWkatg+dk+++++ +
Araip.D7N1Q 11 LPPGFRFHPSDEELIVHYLRNKVTSSPLPA-SFIAEIDLYKFNPWELP-----------------RKYPNGVRPNRAAGAGYWKATGTDKPIITScGM 90
79****************************.89**************9.................68**************************99778 PP
NAM 98 elvglkktLvfykgrapkgektdWvmheyrl 128
+ +g+kk Lvfykgr pkg+ktdW+mheyrl
Araip.D7N1Q 91 KSIGVKKALVFYKGRPPKGSKTDWIMHEYRL 121
88***************************98 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SuperFamily | SSF101941 | 4.71E-49 | 8 | 127 | IPR003441 | NAC domain |
| PROSITE profile | PS51005 | 40.23 | 11 | 142 | IPR003441 | NAC domain |
| Pfam | PF02365 | 6.8E-24 | 12 | 121 | IPR003441 | NAC domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 142 aa Download sequence Send to blast |
MDKDTSLEIH LPPGFRFHPS DEELIVHYLR NKVTSSPLPA SFIAEIDLYK FNPWELPRKY 60 PNGVRPNRAA GAGYWKATGT DKPIITSCGM KSIGVKKALV FYKGRPPKGS KTDWIMHEYR 120 LHDSLLSNSH KRGSMRVGQL HP |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 3ulx_A | 4e-50 | 2 | 121 | 6 | 140 | Stress-induced transcription factor NAC1 |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription activator that binds to, and transactivates the promoter of the abscisic aldehyde oxidase AAO3. Promotes chlorophyll degradation in leaves by enhancing transcription of AAO3, which leads to increased levels of the senescence-inducing hormone abscisic acid (ABA) (PubMed:25516602). Involved in the control of dehydration in senescing leaves. Binds to the DNA sequence 5'-CACGTAAGT-3' of SAG113 promoter. SAG113 acts as negative regulator of ABA signaling for stomatal closure in leaves, and controls water loss during leaf senescence (PubMed:22184656). Transcription factor of the NAC family involved in senescence. May function in the transition between active cell division and cell expansion (PubMed:16640597). Required for normal seed development and morphology (PubMed:18849494). {ECO:0000269|PubMed:16640597, ECO:0000269|PubMed:18849494, ECO:0000269|PubMed:22184656, ECO:0000269|PubMed:25516602}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Araip.D7N1Q |
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Induced by the heterodimer APETALA3 (AP3)/PISTILLATA (PI) (PubMed:9489703). Induced by senescence (PubMed:22184656, PubMed:24659488, PubMed:25516602). Induced by abscisic acid (ABA) (PubMed:22184656, PubMed:25516602). Induced by ethylene (PubMed:25516602). {ECO:0000269|PubMed:22184656, ECO:0000269|PubMed:24659488, ECO:0000269|PubMed:25516602, ECO:0000269|PubMed:9489703}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AC128638 | 1e-40 | AC128638.34 Medicago truncatula clone mth2-36h10, complete sequence. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_016207623.1 | 6e-93 | NAC transcription factor 29-like | ||||
| Refseq | XP_025663796.1 | 7e-93 | NAC transcription factor 29 | ||||
| Swissprot | O49255 | 2e-60 | NAC29_ARATH; NAC transcription factor 29 | ||||
| TrEMBL | A0A444YN48 | 2e-91 | A0A444YN48_ARAHY; Uncharacterized protein | ||||
| STRING | GLYMA05G15533.1 | 9e-83 | (Glycine max) | ||||
| STRING | GLYMA19G36421.1 | 4e-82 | (Glycine max) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF2416 | 29 | 81 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G69490.1 | 8e-63 | NAC-like, activated by AP3/PI | ||||




