PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Araip.DN0Q3

Organism

Arachis ipaensis

Taxonomic ID

130454

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis

Family

MYB_related

Protein Properties

Length: 94aa MW: 11012.6 Da PI: 9.2814

Description

MYB_related family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Araip.DN0Q3	genome	NCGR_PGC	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	49.8	7.7e-16	21	68	1	48
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g+WT+ Ed +l++ vk+ G g+W++I + ++R +k+c++rw+++l Araip.DN0Q3 21 KGPWTPIEDAILIEQVKKCGEGNWSLIQKNSELRRNGKSCRLRWLNHL 68 79********************************************97 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS51294	25.607	16	72	IPR017930	Myb domain
Gene3D	G3DSA:1.10.10.60	2.3E-20	19	67	IPR009057	Homeodomain-like
SMART	SM00717	4.0E-14	20	70	IPR001005	SANT/Myb domain
SuperFamily	SSF46689	5.26E-21	22	91	IPR009057	Homeodomain-like
CDD	cd00167	1.10E-9	23	68	No hit	No description
Pfam	PF13921	1.7E-16	24	83	No hit	No description
Gene3D	G3DSA:1.10.10.60	1.0E-6	68	91	IPR009057	Homeodomain-like

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 94 aa Download sequence Send to blast
MISNINKNNE DGKSWRDDLR KGPWTPIEDA ILIEQVKKCG EGNWSLIQKN SELRRNGKSC 60 RLRWLNHLRP DLKKGPFSEE EEKLIGDLHA KIIY

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1a5j_A	3e-16	18	89	4	74	B-MYB
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcriptional activator of alpha-amylase expression that binds to 5'-CAACTGTC-3' motif in target gene promoter (PubMed:11743113). In vegetative tissues, inhibits growth by reducing cell proliferation. Promotes the expression of aleurone-related genes (e.g. CP1, CP, GASA1, BXL1 and BXL2) in seeds. Together with MYB33 and MYB101, promotes the programmed cell death (PCD) the vacuolation of protein storage vacuoles (PSVs) in the aleurone layers during seed germination (PubMed:20699403). Together with MYB33, facilitates anther and tapetum development (PubMed:15722475). {ECO:0000269\|PubMed:11743113, ECO:0000269\|PubMed:15722475, ECO:0000269\|PubMed:20699403}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Araip.DN0Q3

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Repressed by microRNA159 (miR159a and miR159b) in vegetative tissues (PubMed:20699403, PubMed:17916625, PubMed:15226253). Specific expression in floral organs and in the shoot apices is regulated via miR159-mediated degradation (PubMed:15722475). Slightly induced by ethylene and salicylic acid (PubMed:16463103). {ECO:0000269\|PubMed:15226253, ECO:0000269\|PubMed:15722475, ECO:0000269\|PubMed:16463103, ECO:0000269\|PubMed:17916625, ECO:0000269\|PubMed:20699403}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_025669791.1	9e-60	transcription factor MYB4-like
Swissprot	Q9FR97	3e-29	MYB65_ARATH; Transcription factor MYB65
TrEMBL	A0A445BWS5	5e-48	A0A445BWS5_ARAHY; Uncharacterized protein
STRING	XP_006432323.1	7e-31	(Citrus clementina)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF31	34	817

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT3G11440.1	1e-31	myb domain protein 65

Publications ? help Back to Top
Duarte JM, et al. Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546] Allen RS, et al. Genetic analysis reveals functional redundancy and the major target genes of the Arabidopsis miR159 family. Proc. Natl. Acad. Sci. U.S.A., 2007. 104(41): p. 16371-6 [PMID:17916625] Li J,Reichel M,Millar AA Determinants beyond both complementarity and cleavage govern microR159 efficacy in Arabidopsis. PLoS Genet., 2014. 10(3): p. e1004232 [PMID:24626050] Li Y,Alonso-Peral M,Wong G,Wang MB,Millar AA Ubiquitous miR159 repression of MYB33/65 in Arabidopsis rosettes is robust and is not perturbed by a wide range of stresses. BMC Plant Biol., 2016. 16(1): p. 179 [PMID:27542984] Liu B,De Storme N,Geelen D Gibberellin Induces Diploid Pollen Formation by Interfering with Meiotic Cytokinesis. Plant Physiol., 2017. 173(1): p. 338-353 [PMID:27621423] Zheng Z, et al. Target RNA Secondary Structure Is a Major Determinant of miR159 Efficacy. Plant Physiol., 2017. 174(3): p. 1764-1778 [PMID:28515145] Xue T,Liu Z,Dai X,Xiang F Primary root growth in Arabidopsis thaliana is inhibited by the miR159 mediated repression of MYB33, MYB65 and MYB101. Plant Sci., 2017. 262: p. 182-189 [PMID:28716415] Kim MH, et al. Poplar MYB transcription factor PtrMYB012 and its Arabidopsis AtGAMYB orthologs are differentially repressed by the Arabidopsis miR159 family. Tree Physiol., 2018. 38(6): p. 801-812 [PMID:29301041]