![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Araip.DN0Q3 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
|
||||||||
| Family | MYB_related | ||||||||
| Protein Properties | Length: 94aa MW: 11012.6 Da PI: 9.2814 | ||||||||
| Description | MYB_related family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Myb_DNA-binding | 49.8 | 7.7e-16 | 21 | 68 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
+g+WT+ Ed +l++ vk+ G g+W++I + ++R +k+c++rw+++l
Araip.DN0Q3 21 KGPWTPIEDAILIEQVKKCGEGNWSLIQKNSELRRNGKSCRLRWLNHL 68
79********************************************97 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS51294 | 25.607 | 16 | 72 | IPR017930 | Myb domain |
| Gene3D | G3DSA:1.10.10.60 | 2.3E-20 | 19 | 67 | IPR009057 | Homeodomain-like |
| SMART | SM00717 | 4.0E-14 | 20 | 70 | IPR001005 | SANT/Myb domain |
| SuperFamily | SSF46689 | 5.26E-21 | 22 | 91 | IPR009057 | Homeodomain-like |
| CDD | cd00167 | 1.10E-9 | 23 | 68 | No hit | No description |
| Pfam | PF13921 | 1.7E-16 | 24 | 83 | No hit | No description |
| Gene3D | G3DSA:1.10.10.60 | 1.0E-6 | 68 | 91 | IPR009057 | Homeodomain-like |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 94 aa Download sequence Send to blast |
MISNINKNNE DGKSWRDDLR KGPWTPIEDA ILIEQVKKCG EGNWSLIQKN SELRRNGKSC 60 RLRWLNHLRP DLKKGPFSEE EEKLIGDLHA KIIY |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1a5j_A | 3e-16 | 18 | 89 | 4 | 74 | B-MYB |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcriptional activator of alpha-amylase expression that binds to 5'-CAACTGTC-3' motif in target gene promoter (PubMed:11743113). In vegetative tissues, inhibits growth by reducing cell proliferation. Promotes the expression of aleurone-related genes (e.g. CP1, CP, GASA1, BXL1 and BXL2) in seeds. Together with MYB33 and MYB101, promotes the programmed cell death (PCD) the vacuolation of protein storage vacuoles (PSVs) in the aleurone layers during seed germination (PubMed:20699403). Together with MYB33, facilitates anther and tapetum development (PubMed:15722475). {ECO:0000269|PubMed:11743113, ECO:0000269|PubMed:15722475, ECO:0000269|PubMed:20699403}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Araip.DN0Q3 |
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Repressed by microRNA159 (miR159a and miR159b) in vegetative tissues (PubMed:20699403, PubMed:17916625, PubMed:15226253). Specific expression in floral organs and in the shoot apices is regulated via miR159-mediated degradation (PubMed:15722475). Slightly induced by ethylene and salicylic acid (PubMed:16463103). {ECO:0000269|PubMed:15226253, ECO:0000269|PubMed:15722475, ECO:0000269|PubMed:16463103, ECO:0000269|PubMed:17916625, ECO:0000269|PubMed:20699403}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_025669791.1 | 9e-60 | transcription factor MYB4-like | ||||
| Swissprot | Q9FR97 | 3e-29 | MYB65_ARATH; Transcription factor MYB65 | ||||
| TrEMBL | A0A445BWS5 | 5e-48 | A0A445BWS5_ARAHY; Uncharacterized protein | ||||
| STRING | XP_006432323.1 | 7e-31 | (Citrus clementina) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF31 | 34 | 817 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT3G11440.1 | 1e-31 | myb domain protein 65 | ||||




