PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Araip.G2GUM

Organism

Arachis ipaensis

Taxonomic ID

130454

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis

Family

bZIP

Protein Properties

Length: 106aa MW: 12215.9 Da PI: 11.4851

Description

bZIP family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Araip.G2GUM	genome	NCGR_PGC	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	bZIP_1	53.4	5.8e-17	36	80	5	50
CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS bZIP_1 5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkele 50 +r++r++kNRe+A rsR+RK+a+++eLe+kv Le+eN++L+ + Araip.G2GUM 36 RRQKRMIKNRESAARSRARKQAYTQELENKVSRLEEENERLRR-QQ 80 79***************************************94.44 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PRINTS	PR00041	9.5E-6	31	47	IPR001630	cAMP response element binding (CREB) protein
SMART	SM00338	4.9E-12	32	104	IPR004827	Basic-leucine zipper domain
PROSITE profile	PS50217	11.852	34	79	IPR004827	Basic-leucine zipper domain
Pfam	PF00170	1.4E-13	36	79	IPR004827	Basic-leucine zipper domain
SuperFamily	SSF57959	5.56E-12	36	81	No hit	No description
CDD	cd14707	2.63E-19	36	81	No hit	No description
Gene3D	G3DSA:1.20.5.170	6.4E-15	36	80	No hit	No description
PROSITE pattern	PS00036	0	39	54	IPR004827	Basic-leucine zipper domain
PRINTS	PR00041	9.5E-6	49	69	IPR001630	cAMP response element binding (CREB) protein
PRINTS	PR00041	9.5E-6	69	86	IPR001630	cAMP response element binding (CREB) protein

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0043565	Molecular Function	sequence-specific DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 106 aa Download sequence Send to blast
MVTMSPSSLM GTLSDTQTPG RKRVASGTVV EKTVERRQKR MIKNRESAAR SRARKQAYTQ 60 ELENKVSRLE EENERLRRQQ EIEKVLPSEP PPEPKRQLRR TSSGPL

Functional Description ? help Back to Top
Source	Description
UniProt	Binds to the embryo specification element and the ABA-responsive element (ABRE) of the Dc3 gene promoter. Could participate in abscisic acid-regulated gene expression during seed development.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Araip.G2GUM

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_016161875.2	2e-67	LOW QUALITY PROTEIN: ABSCISIC ACID-INSENSITIVE 5-like protein 2
Refseq	XP_025658183.1	3e-67	ABSCISIC ACID-INSENSITIVE 5-like protein 2
Swissprot	Q9LES3	6e-55	AI5L2_ARATH; ABSCISIC ACID-INSENSITIVE 5-like protein 2
TrEMBL	A0A445CRV2	2e-65	A0A445CRV2_ARAHY; Uncharacterized protein
STRING	AES81050	8e-54	(Medicago truncatula)
STRING	Bostr.20505s0068.1.p	8e-54	(Boechera stricta)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF3755	32	52

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT3G56850.1	2e-44	ABA-responsive element binding protein 3

Publications ? help Back to Top
Kim H, et al. ABA-HYPERSENSITIVE BTB/POZ PROTEIN 1 functions as a negative regulator in ABA-mediated inhibition of germination in Arabidopsis. Plant Mol. Biol., 2016. 90(3): p. 303-15 [PMID:26667153] Song C,Kim T,Chung WS,Lim CO The Arabidopsis Phytocystatin AtCYS5 Enhances Seed Germination and Seedling Growth under Heat Stress Conditions. Mol. Cells, 2017. 40(8): p. 577-586 [PMID:28756655]