PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Araip.HUG3D

Organism

Arachis ipaensis

Taxonomic ID

130454

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis

Family

CAMTA

Protein Properties

Length: 119aa MW: 13729.5 Da PI: 8.4528

Description

CAMTA family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Araip.HUG3D	genome	NCGR_PGC	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	CG-1	116.6	1.3e-36	1	71	47	117
CG-1 47 vryfrkDGyswkkkkdgktvrEdhekLKvggvevlycyYahseenptfqrrcywlLeeelekivlvhylev 117 +r+fr+DG++w+kkkd +tv E+he+LKvg++e+l+cyYah+e+nptfqrr+yw+L+ ++e+i+lvhy+++ Araip.HUG3D 1 MRFFRRDGHNWHKKKDERTVGEAHERLKVGTIEALNCYYAHGEQNPTFQRRSYWMLDLAYEHIILVHYRTT 71 59******************************************************************987 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SMART	SM01076	1.4E-22	1	72	IPR005559	CG-1 DNA-binding domain
PROSITE profile	PS51437	51.734	1	77	IPR005559	CG-1 DNA-binding domain
Pfam	PF03859	5.3E-30	2	70	IPR005559	CG-1 DNA-binding domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 119 aa Download sequence Send to blast
MRFFRRDGHN WHKKKDERTV GEAHERLKVG TIEALNCYYA HGEQNPTFQR RSYWMLDLAY 60 EHIILVHYRT TSEVKAKETK SKKVGMAINV DYGGVVVTVE SLSSALETLK DGVLNEAET

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription activator that binds to the DNA consensus sequence 5'-[ACG]CGCG[GTC]-3' (By similarity). Regulates transcriptional activity in response to calcium signals (Probable). Binds calmodulin in a calcium-dependent manner (By similarity). Involved together with CAMTA2 and CAMTA3 in the positive regulation of a general stress response (PubMed:25039701). {ECO:0000250\|UniProtKB:Q8GSA7, ECO:0000269\|PubMed:25039701, ECO:0000305\|PubMed:11925432}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Araip.HUG3D

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: By heat shock, UVB, salt, wounding, ethylene, methyl jasmonate, abscisic acid, H(2)O(2) and salicylic acid (PubMed:12218065). Induced by cold stress (PubMed:28351986). {ECO:0000269\|PubMed:12218065, ECO:0000269\|PubMed:28351986}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_020971838.1	2e-51	calmodulin-binding transcription activator 4-like
Swissprot	Q9FYG2	3e-34	CMTA4_ARATH; Calmodulin-binding transcription activator 4
TrEMBL	A0A445DL86	1e-44	A0A445DL86_ARAHY; Uncharacterized protein
STRING	GLYMA05G28090.2	7e-39	(Glycine max)
STRING	AET04958	6e-40	(Medicago truncatula)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF14241	18	19

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G67310.1	1e-36	Calmodulin-binding transcription activator protein with CG-1 and Ankyrin domains

Publications ? help Back to Top
Benn G, et al. A key general stress response motif is regulated non-uniformly by CAMTA transcription factors. Plant J., 2014. 80(1): p. 82-92 [PMID:25039701] Kidokoro S, et al. Different Cold-Signaling Pathways Function in the Responses to Rapid and Gradual Decreases in Temperature. Plant Cell, 2017. 29(4): p. 760-774 [PMID:28351986]