PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Araip.KM0ZG

Organism

Arachis ipaensis

Taxonomic ID

130454

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis

Family

NAC

Protein Properties

Length: 143aa MW: 16571.5 Da PI: 8.4045

Description

NAC family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Araip.KM0ZG	genome	NCGR_PGC	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	NAM	118.8	5e-37	8	122	1	128
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk.kg 97 lppGfrF Ptdeelvv++L++k++ +++ +vi+++d+y+++Pw+L+ e ++wy++s+r +nr+t++gyW+ g +++v+s+ ++ Araip.KM0ZG 8 LPPGFRFYPTDEELVVHFLQRKAALLPCHP-DVIPDLDLYSFDPWELD-----EGNQWYYYSRRT--------QNRVTANGYWNPMGIEEAVVSNsSN 91 79***********************999.99**********8.....779**984........58*************998677 PP NAM 98 elvglkktLvfykgrapkgektdWvmheyrl 128 + vg+kk vfy g+ap+g++t+W+m+eyrl Araip.KM0ZG 92 RRVGIKKFYVFYVGEAPHGNRTNWIMQEYRL 122 78*************************98 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SuperFamily	SSF101941	6.8E-44	6	128	IPR003441	NAC domain
PROSITE profile	PS51005	42.498	8	143	IPR003441	NAC domain
Pfam	PF02365	1.6E-22	9	122	IPR003441	NAC domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 143 aa Download sequence Send to blast
MGDSNVNLPP GFRFYPTDEE LVVHFLQRKA ALLPCHPDVI PDLDLYSFDP WELDEGNQWY 60 YYSRRTQNRV TANGYWNPMG IEEAVVSNSS NRRVGIKKFY VFYVGEAPHG NRTNWIMQEY 120 RLSDSAASSS RSSTKRKSQP KTL

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1ut4_A	4e-36	4	122	13	142	NO APICAL MERISTEM PROTEIN
1ut4_B	4e-36	4	122	13	142	NO APICAL MERISTEM PROTEIN
1ut7_A	4e-36	4	122	13	142	NO APICAL MERISTEM PROTEIN
1ut7_B	4e-36	4	122	13	142	NO APICAL MERISTEM PROTEIN
3swm_A	5e-36	4	122	16	145	NAC domain-containing protein 19
3swm_B	5e-36	4	122	16	145	NAC domain-containing protein 19
3swm_C	5e-36	4	122	16	145	NAC domain-containing protein 19
3swm_D	5e-36	4	122	16	145	NAC domain-containing protein 19
3swp_A	5e-36	4	122	16	145	NAC domain-containing protein 19
3swp_B	5e-36	4	122	16	145	NAC domain-containing protein 19
3swp_C	5e-36	4	122	16	145	NAC domain-containing protein 19
3swp_D	5e-36	4	122	16	145	NAC domain-containing protein 19
4dul_A	4e-36	4	122	13	142	NAC domain-containing protein 19
4dul_B	4e-36	4	122	13	142	NAC domain-containing protein 19
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Probable transcription factor that influences tracheary elements and xylem development by negatively regulating secondary cell wall fiber synthesis and programmed cell death. {ECO:0000269\|PubMed:18069942, ECO:0000269\|PubMed:20458494}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Araip.KM0ZG

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_029153137.1	4e-94	NAC domain-containing protein 104 isoform X1
Swissprot	Q8GWK6	4e-57	NC104_ARATH; NAC domain-containing protein 104
TrEMBL	A0A444ZTA0	1e-85	A0A444ZTA0_ARAHY; Uncharacterized protein
TrEMBL	A0A444ZTP3	2e-85	A0A444ZTP3_ARAHY; Uncharacterized protein
STRING	GLYMA08G08010.1	1e-73	(Glycine max)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF1736	33	95

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G64530.1	5e-58	xylem NAC domain 1

Publications ? help Back to Top
Zhao C, et al. XYLEM NAC DOMAIN1, an angiosperm NAC transcription factor, inhibits xylem differentiation through conserved motifs that interact with RETINOBLASTOMA-RELATED. New Phytol., 2017. 216(1): p. 76-89 [PMID:28742236] Tang N, et al. Natural variation at XND1 impacts root hydraulics and trade-off for stress responses in Arabidopsis. Nat Commun, 2018. 9(1): p. 3884 [PMID:30250259]