PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Araip.P53WL

Organism

Arachis ipaensis

Taxonomic ID

130454

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis

Family

MYB

Protein Properties

Length: 238aa MW: 26367.8 Da PI: 9.8445

Description

MYB family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Araip.P53WL	genome	NCGR_PGC	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	47.8	3.3e-15	14	70	1	48
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHT.........TTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmg.........kgRtlkqcksrwqkyl 48 +g+WT+eEd++l ++++G g+W++ ++ g + R++k+c++rw +yl Araip.P53WL 14 KGPWTAEEDQILTSFIHRYGHGNWRALPKQAGisnnvyllrLLRCGKSCRLRWINYL 70 79*****************************************************97 PP
2	Myb_DNA-binding	55.5	1.3e-17	76	121	1	48
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg++++eE+e ++++++ lG++ W++Ia++++ gRt++++k++w+++l Araip.P53WL 76 RGKFSKEEEEAILKLHAVLGNR-WSAIAARLP-GRTDNEIKNFWHTHL 121 89******************.*****.**********986 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS51294	12.734	9	70	IPR017930	Myb domain
SuperFamily	SSF46689	1.68E-28	10	117	IPR009057	Homeodomain-like
SMART	SM00717	3.5E-12	13	72	IPR001005	SANT/Myb domain
Pfam	PF00249	4.4E-14	14	70	IPR001005	SANT/Myb domain
Gene3D	G3DSA:1.10.10.60	4.2E-23	15	77	IPR009057	Homeodomain-like
CDD	cd00167	1.08E-9	16	70	No hit	No description
PROSITE profile	PS51294	27.509	71	125	IPR017930	Myb domain
SMART	SM00717	2.0E-17	75	123	IPR001005	SANT/Myb domain
Pfam	PF00249	3.4E-16	76	121	IPR001005	SANT/Myb domain
CDD	cd00167	8.95E-13	78	121	No hit	No description
Gene3D	G3DSA:1.10.10.60	4.4E-27	78	125	IPR009057	Homeodomain-like

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 238 aa Download sequence Send to blast
MAKTPCCERM GLKKGPWTAE EDQILTSFIH RYGHGNWRAL PKQAGISNNV YLLRLLRCGK 60 SCRLRWINYL RPDIKRGKFS KEEEEAILKL HAVLGNRWSA IAARLPGRTD NEIKNFWHTH 120 LKKRIEKSEV HNNGINSSKY SSCSSQIITM PRVVPAIAPS SGSGSAASSF NDGLSSTSRN 180 RSSSSPNIIA GPGFCSATTS SSDDTSGETM GNHNDGSIQL SEEMEFWYNI FIKSGQLS

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1a5j_A	2e-27	12	126	5	109	B-MYB
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor involved in cold-regulation of CBF genes and in the development of freezing tolerance. May be part of a complex network of transcription factors controlling the expression of CBF genes and other genes in response to cold stress. Binds to the MYB recognition sequences in the promoters of CBF1, CBF2 and CBF3 genes (PubMed:17015446). Involved in drought and salt tolerance. May enhance expression levels of genes involved in abscisic acid (ABA) biosynthesis and signaling, as well as those encoding stress-protective proteins (PubMed:19161942). {ECO:0000269\|PubMed:17015446, ECO:0000269\|PubMed:19161942}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Araip.P53WL

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Induced by abscisic acid (ABA) and drought stress (PubMed:19161942). Induced by salt stress (PubMed:19161942). {ECO:0000269\|PubMed:19161942}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	KF208656	0.0	KF208656.1 Arachis hypogaea putative R2R3 MYB protein 2 (MYB2) gene, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_016205370.1	1e-144	myb-related protein Myb4-like isoform X1
Refseq	XP_025663556.1	1e-144	transcription factor MYB4
Swissprot	Q9LTC4	6e-68	MYB15_ARATH; Transcription factor MYB15
TrEMBL	A0A444YKM1	1e-143	A0A444YKM1_ARAHY; Uncharacterized protein
STRING	XP_007147213.1	4e-91	(Phaseolus vulgaris)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF31	34	817

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT3G23250.1	2e-68	myb domain protein 15

Publications ? help Back to Top
Schnaubelt D, et al. Low glutathione regulates gene expression and the redox potentials of the nucleus and cytosol in Arabidopsis thaliana. Plant Cell Environ., 2015. 38(2): p. 266-79 [PMID:24329757] Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Ma X, et al. CYCLIN-DEPENDENT KINASE G2 regulates salinity stress response and salt mediated flowering in Arabidopsis thaliana. Plant Mol. Biol., 2015. 88(3): p. 287-99 [PMID:25948280] Kim SH, et al. Phosphorylation of the transcriptional repressor MYB15 by mitogen-activated protein kinase 6 is required for freezing tolerance in Arabidopsis. Nucleic Acids Res., 2017. 45(11): p. 6613-6627 [PMID:28510716] Chezem WR,Memon A,Li FS,Weng JK,Clay NK SG2-Type R2R3-MYB Transcription Factor MYB15 Controls Defense-Induced Lignification and Basal Immunity in Arabidopsis. Plant Cell, 2017. 29(8): p. 1907-1926 [PMID:28733420] Pal S, et al. TransDetect Identifies a New Regulatory Module Controlling Phosphate Accumulation. Plant Physiol., 2017. 175(2): p. 916-926 [PMID:28827455]