PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Araip.QF82S

Organism

Arachis ipaensis

Taxonomic ID

130454

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis

Family

MYB_related

Protein Properties

Length: 154aa MW: 16570.7 Da PI: 9.7807

Description

MYB_related family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Araip.QF82S	genome	NCGR_PGC	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	47.1	5.7e-15	87	131	3	47
SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 +WT+eE+ +++ + ++lG+g+W+ I+r + ++Rt+ q+ s+ qky Araip.QF82S 87 AWTEEEHRRFLVGLEKLGKGDWRGISRNFVTTRTPTQVASHAQKY 131 7*******************************************9 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS50158	8.565	3	20	IPR001878	Zinc finger, CCHC-type
PROSITE profile	PS51294	18.119	80	136	IPR017930	Myb domain
SuperFamily	SSF46689	2.15E-18	82	137	IPR009057	Homeodomain-like
TIGRFAMs	TIGR01557	7.4E-19	83	134	IPR006447	Myb domain, plants
SMART	SM00717	1.6E-10	84	134	IPR001005	SANT/Myb domain
Gene3D	G3DSA:1.10.10.60	2.0E-11	84	130	IPR009057	Homeodomain-like
Pfam	PF00249	2.5E-12	87	131	IPR001005	SANT/Myb domain
CDD	cd00167	4.01E-10	87	132	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding
GO:0008270	Molecular Function	zinc ion binding

Sequence ? help Back to Top
Protein Sequence Length: 154 aa Download sequence Send to blast
MGRKCSHCGN VGHNSRTCTS SSFLGIRLFG THLLADPSSS SSSASMMTMN NKCFSMDSLT 60 LFPTTTTTAS GYLSDGAPPQ DKKKGVAWTE EEHRRFLVGL EKLGKGDWRG ISRNFVTTRT 120 PTQVASHAQK YFLRLANTCA TTGSGPHSCT APTT

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription repressor that binds to 5'-TATCCA-3' elements in gene promoters. Contributes to the sugar-repressed transcription of promoters containing SRS or 5'-TATCCA-3' elements. Transcription repressor involved in a cold stress response pathway that confers cold tolerance. Suppresses the DREB1-dependent signaling pathway under prolonged cold stress. DREB1 responds quickly and transiently while MYBS3 responds slowly to cold stress. They may act sequentially and complementarily for adaptation to short- and long-term cold stress (PubMed:20130099). {ECO:0000269\|PubMed:12172034, ECO:0000269\|PubMed:20130099}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Araip.QF82S

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Repressed by sucrose and gibberellic acid (GA) (PubMed:12172034). Induced by cold stress in roots and shoots. Induced by salt stress in shoots. Down-regulated by abscisic aci (ABA) in shoots (PubMed:20130099). {ECO:0000269\|PubMed:12172034, ECO:0000269\|PubMed:20130099}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	KF208671	1e-179	KF208671.1 Arachis hypogaea putative MYB-related protein 17 (MYB17) gene, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_016193462.1	2e-99	transcription factor MYBS3
Refseq	XP_025636845.1	2e-99	transcription factor MYBS3
Swissprot	Q7XC57	1e-40	MYBS3_ORYSJ; Transcription factor MYBS3
TrEMBL	A0A445DUY1	5e-82	A0A445DUY1_ARAHY; Uncharacterized protein
TrEMBL	V5T709	1e-82	V5T709_ARAHY; Putative MYB-related protein 17
STRING	XP_007152917.1	2e-54	(Phaseolus vulgaris)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF3213	32	71

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G56840.1	7e-51	MYB_related family protein

Publications ? help Back to Top
Rice Chromosome 10 Sequencing Consortium In-depth view of structure, activity, and evolution of rice chromosome 10. Science, 2003. 300(5625): p. 1566-9 [PMID:12791992] Kikuchi S, et al. Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice. Science, 2003. 301(5631): p. 376-9 [PMID:12869764] Su CF, et al. A novel MYBS3-dependent pathway confers cold tolerance in rice. Plant Physiol., 2010. 153(1): p. 145-58 [PMID:20130099]