![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Araip.YS8A5 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
|
||||||||
| Family | MYB | ||||||||
| Protein Properties | Length: 183aa MW: 21312.2 Da PI: 10.4774 | ||||||||
| Description | MYB family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Myb_DNA-binding | 34.2 | 5.9e-11 | 43 | 85 | 5 | 48 |
-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
Myb_DNA-binding 5 TteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
T +Ed++l + v +G+++W Ia+++ +t qc+ rw++yl
Araip.YS8A5 43 TLQEDDILREQVGIHGTENWGIIASKFK-DKTTRQCRRRWFTYL 85
779************************9.*************97 PP
| |||||||
| 2 | Myb_DNA-binding | 48.6 | 1.9e-15 | 91 | 136 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
+g W++eEd ll +a k++G++ W+ I++ ++ gRt++ +k+r+ +++
Araip.YS8A5 91 KGGWSPEEDMLLCEAQKLFGNR-WTEISKVVP-GRTDNAVKNRFSTLR 136
688*******************.*********.**********98875 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS51294 | 9.95 | 25 | 85 | IPR017930 | Myb domain |
| SMART | SM00717 | 1.4E-6 | 38 | 87 | IPR001005 | SANT/Myb domain |
| Pfam | PF00249 | 5.0E-10 | 43 | 85 | IPR001005 | SANT/Myb domain |
| CDD | cd00167 | 2.38E-8 | 43 | 85 | No hit | No description |
| Gene3D | G3DSA:1.10.10.60 | 5.5E-18 | 44 | 92 | IPR009057 | Homeodomain-like |
| SuperFamily | SSF46689 | 5.74E-26 | 64 | 143 | IPR009057 | Homeodomain-like |
| PROSITE profile | PS51294 | 21.81 | 86 | 140 | IPR017930 | Myb domain |
| SMART | SM00717 | 3.5E-15 | 90 | 138 | IPR001005 | SANT/Myb domain |
| Pfam | PF00249 | 3.9E-14 | 91 | 135 | IPR001005 | SANT/Myb domain |
| Gene3D | G3DSA:1.10.10.60 | 3.6E-20 | 93 | 139 | IPR009057 | Homeodomain-like |
| CDD | cd00167 | 1.72E-10 | 94 | 135 | No hit | No description |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 183 aa Download sequence Send to blast |
MQDNMKKQKQ KQVVVVANNE ESNKKKEHRI VMWTQEVPSS LTTLQEDDIL REQVGIHGTE 60 NWGIIASKFK DKTTRQCRRR WFTYLNSDFK KGGWSPEEDM LLCEAQKLFG NRWTEISKVV 120 PGRTDNAVKN RFSTLRKKRA KYEALAKENH TSYTNSNNKR VILQHGYVTD SASESGVSTK 180 KMR |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1a5j_A | 2e-26 | 43 | 138 | 11 | 107 | B-MYB |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription factor that binds to DNA in promoters cis-regulatory element 5'-GGCGCGC-3' of cell cycle genes, including cyclins, cyclin-dependent kinases (CDKs), and components of the pre-replication complex (PubMed:20675570, PubMed:24687979). Binds to DNA in promoters cis-regulatory element 5'-AGCCG-3' of auxin regulated genes (e.g. PIN3 and PIN7) (PubMed:26578169). Together with FAMA and MYB124, ensures that stomata contain just two guard cells (GCs) by enforcing a single symmetric precursor cell division before stomatal maturity (PubMed:24571519). Represses the expression of the mitosis-inducing factors CDKB1-1 and CDKA-1, specifically required for the last guard mother cells (GMC) symmetric divisions in the stomatal pathway (PubMed:20675570, PubMed:24687979). Represses CYCA2-3 in newly formed guard cells (PubMed:21772250). Together with MYB88, regulates stomata spacing by restricting divisions late in the stomatal cell lineage thus limiting the number of GMC divisions (PubMed:16155180). In collaboration with CDKB1-1 and CDKB1-2, restrict the G1/S transition and chloroplast and nuclear number during stomatal formation, and normally maintain fate and developmental progression throughout the stomatal cell lineage (PubMed:24123248). Involved in sensing and/or transducing abiotic stress (e.g. drought and salt), probably via the positive regulation of NAC019 (PubMed:21105921). Regulates female reproduction being required for entry into megasporogenesis, probably via the regulation of cell cycle genes (PubMed:22915737). Plays a minor role in lateral roots (LRs) initiation (PubMed:26578065). Involved complementarily in establishing the gravitropic set-point angles of lateral roots by regulating the transcription of PIN3 and PIN7 in gravity-sensing cells of primary and lateral roots (PubMed:26578169). {ECO:0000269|PubMed:16155180, ECO:0000269|PubMed:20675570, ECO:0000269|PubMed:21105921, ECO:0000269|PubMed:21772250, ECO:0000269|PubMed:22915737, ECO:0000269|PubMed:24123248, ECO:0000269|PubMed:24571519, ECO:0000269|PubMed:24687979, ECO:0000269|PubMed:26578065, ECO:0000269|PubMed:26578169}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Araip.YS8A5 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_016202713.1 | 1e-113 | transcription factor MYB124 isoform X1 | ||||
| Refseq | XP_025654602.1 | 1e-113 | transcription factor MYB124 | ||||
| Swissprot | F4IRB4 | 5e-69 | MYB88_ARATH; Transcription factor MYB88 | ||||
| TrEMBL | A0A444Z5M8 | 1e-112 | A0A444Z5M8_ARAHY; Uncharacterized protein | ||||
| STRING | AES96593 | 3e-88 | (Medicago truncatula) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF3480 | 34 | 61 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT2G02820.1 | 1e-70 | myb domain protein 88 | ||||




