PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

BGIOSGA001193-PA

Common Name

OsI_02890

Organism

Oryza sativa subsp. indica

Taxonomic ID

39946

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa

Family

MYB_related

Protein Properties

Length: 79aa MW: 9079.02 Da PI: 5.6438

Description

MYB_related family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
BGIOSGA001193-PA	genome	RIS	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	35	3.3e-11	34	72	4	44
S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHH CS Myb_DNA-binding 4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrw 44 +T+eE+++ + +++ G++ W++Ia +++ gRt++++ +w BGIOSGA001193-PA 34 FTEEEEDIVFRMHRLVGNR-WELIAGRIP-GRTAEEVEKFW 72 9****************.*****.*****9999 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS51294	9.314	26	79	IPR017930	Myb domain
SMART	SM00717	3.5E-8	30	78	IPR001005	SANT/Myb domain
SuperFamily	SSF46689	3.43E-9	33	73	IPR009057	Homeodomain-like
Gene3D	G3DSA:1.10.10.60	2.6E-13	33	72	IPR009057	Homeodomain-like
Pfam	PF00249	4.1E-10	34	72	IPR001005	SANT/Myb domain
CDD	cd00167	7.24E-9	34	72	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0009651	Biological Process	response to salt stress
GO:0009737	Biological Process	response to abscisic acid
GO:0009751	Biological Process	response to salicylic acid
GO:0009753	Biological Process	response to jasmonic acid
GO:0010026	Biological Process	trichome differentiation
GO:0010228	Biological Process	vegetative to reproductive phase transition of meristem
GO:0048765	Biological Process	root hair cell differentiation
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 79 aa Download sequence Send to blast
MESSSGSQLG KNSKTSDDRE TKEVNSTAQN FVHFTEEEED IVFRMHRLVG NRWELIAGRI 60 PGRTAEEVEK FWAIKHQAT

Expression -- UniGene ? help Back to Top
UniGene ID	E-value	Expressed in
Os.41242	2e-72	callus\| leaf\| panicle\| stem

Expression -- Description ? help Back to Top
Source	Description
Uniprot	DEVELOPMENTAL STAGE: Ubiquitous in young leaves. Later, restricted to the leaf base in the trichome initiation zone. In mature leaves, confined to trichome cells. {ECO:0000269\|PubMed:12356720}.
Uniprot	TISSUE SPECIFICITY: Expressed in cotyledons, petioles, rosette leaves, hydathodes, cauline leaves, stems, pedicels and flower buds. {ECO:0000269\|PubMed:22168948, ECO:0000269\|PubMed:22489163}.
Uniprot	TISSUE SPECIFICITY: Expressed in roots, leaves, siliques and inflorescences. {ECO:0000269\|PubMed:12356720}.

Functional Description ? help Back to Top
Source	Description
UniProt	MYB-type transcription factor involved in trichome cell specification. Acts as a negative regulator of trichome patterning and formation. May function by suppressing the expression of GL3. {ECO:0000269\|PubMed:22168948}.
UniProt	Transcription factor. Involved in epidermal cell fate specification. Negative regulator of trichome development, including endoreplication, by lateral inhibition involving intercellular interactions. Promotes the formation of hair developing cells (trichoblasts) in H position in root epidermis, probably by inhibiting non-hair cell (atrichoblasts) formation. {ECO:0000269\|PubMed:10368181, ECO:0000269\|PubMed:12356720}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Negative autoregulation. Repressed by CPC. {ECO:0000269\|PubMed:12356720}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	CT833447	4e-70	CT833447.1 Oryza sativa (indica cultivar-group) cDNA clone:OSIGCSA029N02, full insert sequence.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_006644376.1	1e-42	PREDICTED: MYB-like transcription factor ETC3 isoform X1
Refseq	XP_006644377.1	1e-42	PREDICTED: MYB-like transcription factor ETC3 isoform X1
Refseq	XP_015697875.1	1e-42	PREDICTED: MYB-like transcription factor ETC3 isoform X1
Swissprot	B3H4X8	7e-20	TCL2_ARATH; MYB-like transcription factor TCL2
Swissprot	Q8GV05	8e-20	TRY_ARATH; Transcription factor TRY
TrEMBL	B8ABX3	4e-51	B8ABX3_ORYSI; Uncharacterized protein
STRING	OPUNC01G23150.1	2e-49	(Oryza punctata)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Monocots	OGMP5275	31	57

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT4G01060.1	3e-23	CAPRICE-like MYB3

Publications ? help Back to Top
Perazza D, et al. Trichome cell growth in Arabidopsis thaliana can be derepressed by mutations in at least five genes. Genetics, 1999. 152(1): p. 461-76 [PMID:10224275] Scheres B Plant patterning: TRY to inhibit your neighbors. Curr. Biol., 2002. 12(23): p. R804-6 [PMID:12477405] Duarte JM, et al. Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546] Brininstool G, et al. Constitutive Expressor Of Pathogenesis-related Genes5 affects cell wall biogenesis and trichome development. BMC Plant Biol., 2008. 8: p. 58 [PMID:18485217] Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Xue XY, et al. Interaction between two timing microRNAs controls trichome distribution in Arabidopsis. PLoS Genet., 2014. 10(4): p. e1004266 [PMID:24699192] Nayidu NK, et al. Comparison of five major trichome regulatory genes in Brassica villosa with orthologues within the Brassicaceae. PLoS ONE, 2014. 9(4): p. e95877 [PMID:24755905] Taheri A, et al. A landscape of hairy and twisted: hunting for new trichome mutants in the Saskatoon Arabidopsis T-DNA population. Plant Biol (Stuttg), 2015. 17(2): p. 384-94 [PMID:25348773] Wada T,Hayashi N,Tominaga-Wada R Root hair formation at the root-hypocotyl junction in CPC-LIKE MYB double and triple mutants of Arabidopsis. Plant Signal Behav, 2015. 10(11): p. e1089372 [PMID:26339713] Huang M,Hu Y,Liu X,Li Y,Hou X Arabidopsis LEAFY COTYLEDON1 controls cell fate determination during post-embryonic development. Front Plant Sci, 2015. 6: p. 955 [PMID:26579186] Wada T,Tominaga-Wada R CAPRICE family genes control flowering time through both promoting and repressing CONSTANS and FLOWERING LOCUS T expression. Plant Sci., 2015. 241: p. 260-5 [PMID:26706076] Tian H, et al. NTL8 Regulates Trichome Formation in Arabidopsis by Directly Activating R3 MYB Genes TRY and TCL1. Plant Physiol., 2017. 174(4): p. 2363-2375 [PMID:28649093] Tominaga-Wada R,Wada T Extended C termini of CPC-LIKE MYB proteins confer functional diversity in Arabidopsis epidermal cell differentiation. Development, 2017. 144(13): p. 2375-2380 [PMID:28676568] Kohanová J, et al. Root hair abundance impacts cadmium accumulation in Arabidopsis thaliana shoots. Ann. Bot., 2018. 122(5): p. 903-914 [PMID:29394308] Yamada K,Sasabe M,Fujikawa Y,Wada T,Tominaga-Wada R Amino acid substitutions in CPC-LIKE MYB reveal residues important for protein stability in Arabidopsis roots. PLoS ONE, 2018. 13(10): p. e0205522 [PMID:30308079] Kribii R, et al. Cloning and characterization of the Arabidopsis thaliana SQS1 gene encoding squalene synthase--involvement of the C-terminal region of the enzyme in the channeling of squalene through the sterol pathway. Eur. J. Biochem., 1997. 249(1): p. 61-9 [PMID:9363754]