PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

BGIOSGA002178-PA

Common Name

OsI_00797

Organism

Oryza sativa subsp. indica

Taxonomic ID

39946

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa

Family

M-type_MADS

Protein Properties

Length: 139aa MW: 15190.3 Da PI: 8.9931

Description

M-type_MADS family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
BGIOSGA002178-PA	genome	RIS	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SRF-TF	100.8	5.2e-32	87	136	1	50
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50 krien++nrqvtf+kRrng+lKKA+ELSvLCdaeva+i+fss+g+lyey+ BGIOSGA002178-PA 87 KRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYA 136 79***********************************************8 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SMART	SM00432	1.1E-42	79	138	IPR002100	Transcription factor, MADS-box
PROSITE profile	PS50066	33.992	79	139	IPR002100	Transcription factor, MADS-box
SuperFamily	SSF55455	1.44E-29	80	138	IPR002100	Transcription factor, MADS-box
CDD	cd00265	3.98E-40	80	138	No hit	No description
PROSITE pattern	PS00350	0	81	135	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	1.3E-33	81	101	IPR002100	Transcription factor, MADS-box
Pfam	PF00319	3.2E-27	88	135	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	1.3E-33	101	116	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	1.3E-33	116	137	IPR002100	Transcription factor, MADS-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding
GO:0046983	Molecular Function	protein dimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 139 aa Download sequence Send to blast
MRESPPNFDS LPVQTKQVSD LQQQEAKLCK QSYIRVTCIT YSETDLSCGP SSMTELTAAA 60 APAGSGSSAA VAAGSSEKMG RGKIEIKRIE NTTNRQVTFC KRRNGLLKKA YELSVLCDAE 120 VALIVFSSRG RLYEYANNR

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1tqe_P	1e-21	79	136	1	58	Myocyte-specific enhancer factor 2B
1tqe_Q	1e-21	79	136	1	58	Myocyte-specific enhancer factor 2B
1tqe_R	1e-21	79	136	1	58	Myocyte-specific enhancer factor 2B
1tqe_S	1e-21	79	136	1	58	Myocyte-specific enhancer factor 2B
6c9l_A	1e-21	79	136	1	58	Myocyte-specific enhancer factor 2B
6c9l_B	1e-21	79	136	1	58	Myocyte-specific enhancer factor 2B
6c9l_C	1e-21	79	136	1	58	Myocyte-specific enhancer factor 2B
6c9l_D	1e-21	79	136	1	58	Myocyte-specific enhancer factor 2B
6c9l_E	1e-21	79	136	1	58	Myocyte-specific enhancer factor 2B
6c9l_F	1e-21	79	136	1	58	Myocyte-specific enhancer factor 2B
Search in ModeBase

Expression -- UniGene ? help Back to Top
UniGene ID	E-value	Expressed in
Os.320	7e-52	flower\| panicle

Functional Description ? help Back to Top
Source	Description
UniProt	Probable transcription factor. Interacts genetically with TT16/AGL32 in a partially antagonistic manner during flower development. Is essential for the coordination of cell divisions in ovule, seed coat development and endosperm formation (PubMed:27776173). {ECO:0000269\|PubMed:27776173}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AP003105	1e-160	AP003105.2 Oryza sativa Japonica Group genomic DNA, chromosome 1, PAC clone:P0489A05.
GenBank	AP003197	1e-160	AP003197.4 Oryza sativa Japonica Group genomic DNA, chromosome 1, BAC clone:B1015E06.
GenBank	AP014957	1e-160	AP014957.1 Oryza sativa Japonica Group DNA, chromosome 1, cultivar: Nipponbare, complete sequence.
GenBank	CP012609	1e-160	CP012609.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 1 sequence.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_015632490.1	2e-62	MADS-box transcription factor 3 isoform X1
Refseq	XP_015632498.1	2e-62	MADS-box transcription factor 3 isoform X2
Swissprot	P29385	4e-38	AGL5_ARATH; Agamous-like MADS-box protein AGL5
TrEMBL	A2WLS9	6e-98	A2WLS9_ORYSI; Uncharacterized protein
STRING	OS01T0201700-01	4e-63	(Oryza sativa)
STRING	ONIVA01G08650.1	6e-62	(Oryza nivara)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Monocots	OGMP129	38	398

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT3G58780.2	8e-39	MIKC_MADS family protein

Publications ? help Back to Top
Duarte JM, et al. Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546] Pabón-Mora N,Wong GK,Ambrose BA Evolution of fruit development genes in flowering plants. Front Plant Sci, 2014. 5: p. 300 [PMID:25018763] Rathnakumar K, et al. Angiopoietin-2 mediates thrombin-induced monocyte adhesion and endothelial permeability. J. Thromb. Haemost., 2016. 14(8): p. 1655-67 [PMID:27241812] Balanzà V,Roig-Villanova I,Di Marzo M,Masiero S,Colombo L Seed abscission and fruit dehiscence required for seed dispersal rely on similar genetic networks. Development, 2016. 143(18): p. 3372-81 [PMID:27510967] Ehlers K, et al. The MADS Box Genes ABS, SHP1, and SHP2 Are Essential for the Coordination of Cell Divisions in Ovule and Seed Coat Development and for Endosperm Formation in Arabidopsis thaliana. PLoS ONE, 2016. 11(10): p. e0165075 [PMID:27776173] Sehra B,Franks RG Redundant CArG Box Cis-motif Activity Mediates SHATTERPROOF2 Transcriptional Regulation during Arabidopsis thaliana Gynoecium Development. Front Plant Sci, 2017. 8: p. 1712 [PMID:29085379] Ó'Maoiléidigh DS,Stewart D,Zheng B,Coupland G,Wellmer F Floral homeotic proteins modulate the genetic program for leaf development to suppress trichome formation in flowers. Development, 2018. [PMID:29361563]