![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | BGIOSGA003338-PA | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
|
||||||||
| Family | TALE | ||||||||
| Protein Properties | Length: 110aa MW: 12801.8 Da PI: 10.8558 | ||||||||
| Description | TALE family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Homeobox | 32.2 | 1.8e-10 | 43 | 77 | 21 | 55 |
HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
Homeobox 21 knrypsaeereeLAkklgLterqVkvWFqNrRake 55
+ +yp++e++ +LA+++gL+ +q+ +WF N+R ++
BGIOSGA003338-PA 43 RWPYPTEEDKLRLAARTGLDPKQINNWFINQRKRH 77
469*****************************985 PP
| |||||||
| 2 | ELK | 26.6 | 1.3e-09 | 1 | 18 | 5 | 22 |
ELK 5 qLlrKYsgyLgsLkqEFs 22
+Ll+KYsg+L+ L++EF+
BGIOSGA003338-PA 1 MLLKKYSGCLSRLRSEFL 18
7****************8 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Pfam | PF03789 | 2.3E-6 | 1 | 18 | IPR005539 | ELK domain |
| PROSITE profile | PS50071 | 12.843 | 17 | 80 | IPR001356 | Homeobox domain |
| SuperFamily | SSF46689 | 3.89E-20 | 19 | 84 | IPR009057 | Homeodomain-like |
| SMART | SM00389 | 1.1E-13 | 19 | 84 | IPR001356 | Homeobox domain |
| Gene3D | G3DSA:1.10.10.60 | 7.8E-28 | 22 | 80 | IPR009057 | Homeodomain-like |
| CDD | cd00086 | 8.17E-13 | 29 | 81 | No hit | No description |
| Pfam | PF05920 | 1.1E-17 | 37 | 76 | IPR008422 | Homeobox KN domain |
| PROSITE pattern | PS00027 | 0 | 55 | 78 | IPR017970 | Homeobox, conserved site |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 110 aa Download sequence Send to blast |
MLLKKYSGCL SRLRSEFLKK RKKGKLPKDA RSALLEWWNT HYRWPYPTEE DKLRLAARTG 60 LDPKQINNWF INQRKRHWKP SDGMRFALME GVAGGSSGTT LYFDTGTIGP |
| Nucleic Localization Signal ? help Back to Top | |||
|---|---|---|---|
| No. | Start | End | Sequence |
| 1 | 12 | 21 | LRSEFLKKRK |
| 2 | 18 | 22 | KKRKK |
| Expression -- UniGene ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| UniGene ID | E-value | Expressed in | ||||
| Os.4163 | 0.0 | panicle| stem | ||||
| Expression -- Microarray ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | ID | E-value | ||||
| GEO | 116010677 | 0.0 | ||||
| Expression -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| Uniprot | DEVELOPMENTAL STAGE: Highly expressed in the early globular stage embryo before 2 days after pollination (DAP), but not in the endosperm. At 3 and 4 DAP, expression is restricted to the region around or just below the center of the ventral side of the embryo, where the shoot apex subsequently arises. During the transition to the shoot apex differentiation stage, expression is divided between the upper and basal regions of the shoot area, and the notch between the first leaf primordium and epiblast, respectively. When the first leaf primordia is evident, expression is localized to the notches between the shoot apical meristem (SAM) and the first leaf primordium and the putative second leaf primordium. Expressed uniformly in the inflorescence meristem, but after the transition from inflorescence to the floral phase, located specifically in the notches between the floral meristem and glume primordia. At later stages of flower development, uniformly expressed throughout the corpus of the meristem, and in the notches between glume primordia, but less well defined than in the previous stage. {ECO:0000269|PubMed:10488233}. | |||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Probable transcription factor that may be involved in shoot formation during early embryogenesis. {ECO:0000269|PubMed:10488233}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AB007626 | 0.0 | AB007626.1 Oryza sativa Japonica Group HOS16 mRNA, partial cds. | |||
| GenBank | AK241312 | 0.0 | AK241312.1 Oryza sativa Japonica Group cDNA, clone: J065141L09, full insert sequence. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_015634297.1 | 3e-77 | homeobox protein knotted-1-like 1 | ||||
| Swissprot | Q9FP29 | 3e-78 | KNOS1_ORYSJ; Homeobox protein knotted-1-like 1 | ||||
| TrEMBL | A0A0D9Y7A2 | 7e-76 | A0A0D9Y7A2_9ORYZ; Uncharacterized protein | ||||
| TrEMBL | A2ZS85 | 2e-76 | A2ZS85_ORYSJ; Uncharacterized protein | ||||
| TrEMBL | I1NM88 | 7e-76 | I1NM88_ORYGL; Uncharacterized protein | ||||
| STRING | OGLUM01G14210.1 | 1e-76 | (Oryza glumipatula) | ||||
| STRING | ORGLA01G0097800.1 | 1e-76 | (Oryza glaberrima) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP1698 | 38 | 92 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G62360.1 | 3e-36 | KNOX/ELK homeobox transcription factor | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




