PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

BGIOSGA006773-PA

Common Name

OsI_06594

Organism

Oryza sativa subsp. indica

Taxonomic ID

39946

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa

Family

Dof

Protein Properties

Length: 255aa MW: 25778.4 Da PI: 8.9119

Description

Dof family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
BGIOSGA006773-PA	genome	RIS	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	zf-Dof	114.7	4e-36	45	101	6	62
zf-Dof 6 lkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 cprC+s +tkfCyynnys++qPryfC++CrryWt+GG+lrnvPvGgg+rk+k+ss BGIOSGA006773-PA 45 PCCPRCNSIKTKFCYYNNYSMAQPRYFCRECRRYWTQGGSLRNVPVGGGCRKSKRSS 101 569***************************************************986 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS50884	28.081	45	99	IPR003851	Zinc finger, Dof-type
Pfam	PF02701	5.6E-31	46	99	IPR003851	Zinc finger, Dof-type
ProDom	PD007478	1.0E-25	47	99	IPR003851	Zinc finger, Dof-type
PROSITE pattern	PS01361	0	47	83	IPR003851	Zinc finger, Dof-type

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 255 aa Download sequence Send to blast
MASGGALSPV EEKPAVVKTT KAEQHEEEAA VAVKSAAEMM KKSSPCCPRC NSIKTKFCYY 60 NNYSMAQPRY FCRECRRYWT QGGSLRNVPV GGGCRKSKRS SASSASASAA SPPAPAVGAA 120 APPVVPALSS AISKLLQSEP MAAPCADFPN VLPTFVSTGF ELPAAAGDRL SLGSFGAFGN 180 LSAAVAAPGG GGGSSTTTSF MDMLRGVGGL FDGVGNSHQM GGNGGGGGSY YAPLITGAGN 240 GMLMPPPPLP PFSVL

Expression -- UniGene ? help Back to Top
UniGene ID	E-value	Expressed in
Os.4184	0.0	flower\| panicle\| seed

Expression -- Microarray ? help Back to Top
Source	ID	E-value
GEO	309243064	0.0

Expression -- Description ? help Back to Top
Source	Description
Uniprot	DEVELOPMENTAL STAGE: Expressed in developing seeds from 5 to 30 days after flowering (DAF) (PubMed:16798940). Expressed in germinating seeds up to 5 days after imbibition (PubMed:11470159). {ECO:0000269\|PubMed:11470159, ECO:0000269\|PubMed:16798940}.

Functional Description ? help Back to Top
Source	Description
UniProt	Transcriptional activator that binds specifically to the DNA consensus core sequence 5'-AAAG-3' also known as prolamin box (PubMed:16798940). Can activate the expression of genes encoding for the seed storage proteins glutelin, prolamin and globulin. Functions synergistically with RISBZ/BZIP58 to positively regulate quantitatively many seed storage proteins (PubMed:16798940, PubMed:19473328). Functions synergistically with RISBZ1/BZIP58 to positively regulate some metabolic enzymes, such as alanine aminotransferase and pyruvate phosphate dikinase, that are expressed in developing seeds (PubMed:16798940). Functions synergistically with RISBZ1/BZIP58 to positively regulate genes that are key players in the development of aleurone layers (PubMed:19473328). Functions synergistically with RISBZ1/BZIP58 to positively regulate the glutelin GLUD-1 gene in endosperm of developing seeds (PubMed:18980953). Can activate the expression of the bifunctional lysine-degrading enzyme, lysine ketoglutarate reductase/saccharopine dehydrogenase (LKR/SDH), one of the key regulators determining free lysine content in plants (PubMed:21037241). In germinating seeds, involved in the gibberellin-mediated activation of the alpha-amylase AMY1.1/AMY1A gene (PubMed:14500792). {ECO:0000269\|PubMed:14500792, ECO:0000269\|PubMed:16798940, ECO:0000269\|PubMed:18980953, ECO:0000269\|PubMed:19473328, ECO:0000269\|PubMed:21037241}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Induced by gibberellin. {ECO:0000269\|PubMed:11470159, ECO:0000269\|PubMed:16798940}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	CP012610	0.0	CP012610.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 2 sequence.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_015623741.1	1e-131	dof zinc finger protein 3-like
Swissprot	Q6K537	1e-132	DOF3_ORYSJ; Dof zinc finger protein 3
TrEMBL	B8AFC3	0.0	B8AFC3_ORYSI; Uncharacterized protein
STRING	ONIVA02G12020.1	1e-180	(Oryza nivara)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Monocots	OGMP17398	10	10

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT3G52440.1	6e-30	Dof family protein

Publications ? help Back to Top
Washio K Identification of Dof proteins with implication in the gibberellin-regulated expression of a peptidase gene following the germination of rice grains. Biochim. Biophys. Acta, 2001. 1520(1): p. 54-62 [PMID:11470159] Washio K Functional dissections between GAMYB and Dof transcription factors suggest a role for protein-protein associations in the gibberellin-mediated expression of the RAmy1A gene in the rice aleurone. Plant Physiol., 2003. 133(2): p. 850-63 [PMID:14500792] Yamamoto MP,Onodera Y,Touno SM,Takaiwa F Synergism between RPBF Dof and RISBZ1 bZIP activators in the regulation of rice seed expression genes. Plant Physiol., 2006. 141(4): p. 1694-707 [PMID:16798940] Kawakatsu T,Yamamoto MP,Hirose S,Yano M,Takaiwa F Characterization of a new rice glutelin gene GluD-1 expressed in the starchy endosperm. J. Exp. Bot., 2008. 59(15): p. 4233-45 [PMID:18980953] Kawakatsu T,Yamamoto MP,Touno SM,Yasuda H,Takaiwa F Compensation and interaction between RISBZ1 and RPBF during grain filling in rice. Plant J., 2009. 59(6): p. 908-20 [PMID:19473328] Kawakatsu T,Takaiwa F Differences in transcriptional regulatory mechanisms functioning for free lysine content and seed storage protein accumulation in rice grain. Plant Cell Physiol., 2010. 51(12): p. 1964-74 [PMID:21037241] Gaur VS,Singh US,Kumar A Transcriptional profiling and in silico analysis of Dof transcription factor gene family for understanding their regulation during seed development of rice Oryza sativa L. Mol. Biol. Rep., 2011. 38(4): p. 2827-48 [PMID:21113680] Schmidt R, et al. SALT-RESPONSIVE ERF1 is a negative regulator of grain filling and gibberellin-mediated seedling establishment in rice. Mol Plant, 2014. 7(2): p. 404-21 [PMID:24046061] Fan J, et al. Infection of Ustilaginoidea virens intercepts rice seed formation but activates grain-filling-related genes. J Integr Plant Biol, 2015. 57(6): p. 577-90 [PMID:25319482] Sutoh K, et al. An N-terminal region of a Myb-like protein is involved in its intracellular localization and activation of a gibberellin-inducible proteinase gene in germinated rice seeds. Biosci. Biotechnol. Biochem., 2015. 79(5): p. 747-59 [PMID:25559339]