![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | BGIOSGA010547-PA | ||||||||
| Common Name | OsI_12002 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
|
||||||||
| Family | MYB_related | ||||||||
| Protein Properties | Length: 82aa MW: 9138.59 Da PI: 10.115 | ||||||||
| Description | MYB_related family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Myb_DNA-binding | 43.1 | 9.9e-14 | 2 | 42 | 8 | 48 |
HHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
Myb_DNA-binding 8 EdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
Ed++lv +++++G g W + +++ g++R++k+c++rw++yl
BGIOSGA010547-PA 2 EDDILVSYIAKHGEGKWGALPKRAGLKRCGKSCRLRWLNYL 42
9***************************************7 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SMART | SM00717 | 2.2E-4 | 1 | 44 | IPR001005 | SANT/Myb domain |
| PROSITE profile | PS51294 | 19.025 | 1 | 46 | IPR017930 | Myb domain |
| CDD | cd00167 | 9.38E-9 | 2 | 42 | No hit | No description |
| SuperFamily | SSF46689 | 3.86E-18 | 2 | 69 | IPR009057 | Homeodomain-like |
| Gene3D | G3DSA:1.10.10.60 | 1.0E-16 | 2 | 45 | IPR009057 | Homeodomain-like |
| Pfam | PF00249 | 3.7E-12 | 2 | 42 | IPR001005 | SANT/Myb domain |
| Gene3D | G3DSA:1.10.10.60 | 1.8E-6 | 46 | 69 | IPR009057 | Homeodomain-like |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 82 aa Download sequence Send to blast |
MEDDILVSYI AKHGEGKWGA LPKRAGLKRC GKSCRLRWLN YLRPGIKRGN ISGDEEELIL 60 RLHTLLGNRP VSDPLLSSSP AN |
| Expression -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| Uniprot | DEVELOPMENTAL STAGE: Highly expressed from the very early stages of embryogenesis to the globular stage, decreases rapidly from the late heart-torpedo stage and did not persist after the completion of embryogenesis. | |||||
| Uniprot | TISSUE SPECIFICITY: Expressed at a high level in immature siliques and at a lower level in flowers. Undetected in young seedlings, roots, leaves and inflorescence stems. | |||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription activator, when associated with BHLH2/EGL3/MYC146, BHLH12/MYC1, or BHLH42/TT8. Involved in the control of flavonoid late metabolism in developing siliques. Plays a key role in determining the tissue-specific activation of leucoanthocyanidin reductase (BANYULS). {ECO:0000269|PubMed:15361138}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | D88619 | 1e-111 | D88619.1 Oryza sativa mRNA for OSMYB3, complete cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_015629423.1 | 4e-42 | anthocyanin regulatory C1 protein | ||||
| Swissprot | Q9FJA2 | 2e-33 | TT2_ARATH; Transcription factor TT2 | ||||
| TrEMBL | A2XHV9 | 4e-52 | A2XHV9_ORYSI; Uncharacterized protein | ||||
| TrEMBL | Q75K44 | 4e-52 | Q75K44_ORYSJ; Myb-like protein | ||||
| STRING | ORUFI03G21780.1 | 2e-52 | (Oryza rufipogon) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP116 | 37 | 448 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G35550.1 | 1e-35 | MYB family protein | ||||




