![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | BGIOSGA011509-PA | ||||||||
| Common Name | OsI_09880 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
|
||||||||
| Family | HSF | ||||||||
| Protein Properties | Length: 110aa MW: 11980.5 Da PI: 4.3856 | ||||||||
| Description | HSF family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | HSF_DNA-bind | 85.6 | 6.7e-27 | 39 | 97 | 2 | 60 |
HHHHHHHHHCTGGGTTTSEESSSSSEEEES-HHHHHHHTHHHHSTT--HHHHHHHHHHT CS
HSF_DNA-bind 2 FlkklyeiledeelkeliswsengnsfvvldeeefakkvLpkyFkhsnfaSFvRQLnmY 60
Fl+k+y+++ed++++++isw+e+g++fvv+ + efa+++LpkyFkh+nf+SFvRQLn+Y
BGIOSGA011509-PA 39 FLTKTYQLVEDPAVDDVISWNEDGSTFVVWRPAEFARDLLPKYFKHNNFSSFVRQLNTY 97
9********************************************************** PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:1.10.10.10 | 1.2E-28 | 31 | 99 | IPR011991 | Winged helix-turn-helix DNA-binding domain |
| SMART | SM00415 | 2.6E-23 | 35 | 109 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
| SuperFamily | SSF46785 | 1.04E-24 | 36 | 98 | IPR011991 | Winged helix-turn-helix DNA-binding domain |
| PRINTS | PR00056 | 2.0E-17 | 39 | 62 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
| Pfam | PF00447 | 6.7E-23 | 39 | 97 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
| PRINTS | PR00056 | 2.0E-17 | 77 | 89 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
| PRINTS | PR00056 | 2.0E-17 | 90 | 102 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 110 aa Download sequence Send to blast |
MAEQGAGEAD AGGGEPPAAA VMTAAAEALA GQRSLPTPFL TKTYQLVEDP AVDDVISWNE 60 DGSTFVVWRP AEFARDLLPK YFKHNNFSSF VRQLNTYLSR TASLLSVWML |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 2ldu_A | 6e-19 | 29 | 97 | 11 | 78 | Heat shock factor protein 1 |
| 5d5u_B | 7e-19 | 30 | 100 | 21 | 90 | Heat shock factor protein 1 |
| 5d5v_B | 7e-19 | 30 | 100 | 21 | 90 | Heat shock factor protein 1 |
| 5d5v_D | 7e-19 | 30 | 100 | 21 | 90 | Heat shock factor protein 1 |
| Search in ModeBase | ||||||
| Expression -- UniGene ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| UniGene ID | E-value | Expressed in | ||||
| Os.11941 | 1e-157 | callus| leaf| panicle| root| stem | ||||
| Expression -- Microarray ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | ID | E-value | ||||
| GEO | 32991754 | 1e-157 | ||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcriptional regulator that specifically binds DNA of heat shock promoter elements (HSE). {ECO:0000250}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AP005681 | 1e-159 | AP005681.3 Oryza sativa Japonica Group genomic DNA, chromosome 9, BAC clone:OJ1439_F07. | |||
| GenBank | AP014965 | 1e-159 | AP014965.1 Oryza sativa Japonica Group DNA, chromosome 9, cultivar: Nipponbare, complete sequence. | |||
| GenBank | CP012617 | 1e-159 | CP012617.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 9 sequence. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_015612527.1 | 1e-63 | heat stress transcription factor B-2c isoform X4 | ||||
| Refseq | XP_025876147.1 | 1e-63 | heat stress transcription factor B-2c isoform X5 | ||||
| Swissprot | Q652B0 | 6e-64 | HFB2C_ORYSJ; Heat stress transcription factor B-2c | ||||
| TrEMBL | B8AMF0 | 4e-75 | B8AMF0_ORYSI; Uncharacterized protein | ||||
| STRING | ORUFI09G18440.1 | 8e-63 | (Oryza rufipogon) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP121 | 37 | 394 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT4G11660.1 | 1e-40 | HSF family protein | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




