![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | BGIOSGA019118-PA | ||||||||
| Common Name | OsI_18310 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
|
||||||||
| Family | bZIP | ||||||||
| Protein Properties | Length: 151aa MW: 16202.2 Da PI: 9.7973 | ||||||||
| Description | bZIP family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | bZIP_1 | 41.6 | 2.6e-13 | 27 | 86 | 4 | 63 |
XCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
bZIP_1 4 lkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63
++ +r+ +NRe+ArrsR+RK++++eeL +++ L+a N + ++ + e +k++ e+
BGIOSGA019118-PA 27 ERKRKRMLSNRESARRSRARKQQRLEELIAEAARLQADNARVEAQIGAYAGELSKVDGEN 86
46789999********************************99999999988888877665 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SMART | SM00338 | 4.9E-17 | 24 | 88 | IPR004827 | Basic-leucine zipper domain |
| Gene3D | G3DSA:1.20.5.170 | 2.0E-10 | 26 | 81 | No hit | No description |
| PROSITE profile | PS50217 | 11.024 | 26 | 89 | IPR004827 | Basic-leucine zipper domain |
| Pfam | PF00170 | 2.5E-9 | 28 | 82 | IPR004827 | Basic-leucine zipper domain |
| SuperFamily | SSF57959 | 2.44E-10 | 28 | 80 | No hit | No description |
| PROSITE pattern | PS00036 | 0 | 31 | 46 | IPR004827 | Basic-leucine zipper domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 151 aa Download sequence Send to blast |
MSSPSRRSSS PESNTSGGGG GGYAADERKR KRMLSNRESA RRSRARKQQR LEELIAEAAR 60 LQADNARVEA QIGAYAGELS KVDGENAVLR ARHGELAGRL QALGGVLEIL QVAGAPVDIP 120 EIPDDPLLRP WQPPFAAQPI VATAMADAFQ F |
| Nucleic Localization Signal ? help Back to Top | |||
|---|---|---|---|
| No. | Start | End | Sequence |
| 1 | 40 | 47 | RRSRARKQ |
| Expression -- UniGene ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| UniGene ID | E-value | Expressed in | ||||
| Os.3373 | 0.0 | callus| flower| leaf| panicle| root| seed| stem | ||||
| Expression -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| Uniprot | TISSUE SPECIFICITY: Roots and shoots of young plants, and basal portion of leaves. | |||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | May contribute to developmentally specific patterns of gene expression. Binds specifically to ocs elements which are transcriptional enhancer found in the promoters of several plant genes. OCSBF-1 is able to bind to a site within each half of the ocs element as well as to animal AP-1 and CREB sites. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | CT833673 | 0.0 | CT833673.1 Oryza sativa (indica cultivar-group) cDNA clone:OSIGCRA102G21, full insert sequence. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_015639544.1 | 9e-80 | ocs element-binding factor 1 | ||||
| Swissprot | P24068 | 5e-36 | OCS1_MAIZE; Ocs element-binding factor 1 | ||||
| TrEMBL | A0A0E0H8Y0 | 1e-102 | A0A0E0H8Y0_ORYNI; Uncharacterized protein | ||||
| TrEMBL | A2Y005 | 1e-102 | A2Y005_ORYSI; Uncharacterized protein | ||||
| STRING | ONIVA05G02010.1 | 1e-103 | (Oryza nivara) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP1886 | 35 | 100 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT3G62420.1 | 4e-25 | basic region/leucine zipper motif 53 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




