![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | BGIOSGA022538-PA | ||||||||
| Common Name | OsI_22124 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
|
||||||||
| Family | GRAS | ||||||||
| Protein Properties | Length: 88aa MW: 9347.56 Da PI: 4.5722 | ||||||||
| Description | GRAS family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | GRAS | 47.1 | 4e-15 | 3 | 56 | 165 | 219 |
GRAS 165 LakfAeelgvpfefnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvs 219
L+k Ae+l+vpf+fn+ v++rl++l++e+Lrvk+gEala++++lqlh ll+++ +
BGIOSGA022538-PA 3 LTKEAERLDVPFQFNP-VVSRLDALDVESLRVKTGEALAICFSLQLHCLLASDDD 56
99**************.7*******************************976654 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS50985 | 9.591 | 1 | 88 | IPR005202 | Transcription factor GRAS |
| Pfam | PF03514 | 1.4E-12 | 3 | 56 | IPR005202 | Transcription factor GRAS |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 88 aa Download sequence Send to blast |
MALTKEAERL DVPFQFNPVV SRLDALDVES LRVKTGEALA ICFSLQLHCL LASDDDATAG 60 AGGDKERRSP ESGLSPSKSR ADAFLGAL |
| Expression -- UniGene ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| UniGene ID | E-value | Expressed in | ||||
| Os.58982 | 1e-116 | callus| flower| leaf| root| stem | ||||
| Expression -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| Uniprot | TISSUE SPECIFICITY: Expressed in seedlings, root epidermis, leaves, flowers and siliques. {ECO:0000269|PubMed:10341448, ECO:0000269|PubMed:18500650}. | |||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Probable transcription factor involved in plant development. {ECO:0000250}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AP003458 | 1e-147 | AP003458.4 Oryza sativa Japonica Group genomic DNA, chromosome 6, PAC clone:P0701E03. | |||
| GenBank | AP004687 | 1e-147 | AP004687.2 Oryza sativa Japonica Group genomic DNA, chromosome 6, PAC clone:P0021C04. | |||
| GenBank | AP014962 | 1e-147 | AP014962.1 Oryza sativa Japonica Group DNA, chromosome 6, cultivar: Nipponbare, complete sequence. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_015690954.1 | 1e-49 | PREDICTED: scarecrow-like protein 3 | ||||
| Swissprot | Q9LPR8 | 2e-20 | SCL3_ARATH; Scarecrow-like protein 3 | ||||
| TrEMBL | A0A0E0GNT9 | 1e-55 | A0A0E0GNT9_ORYNI; Uncharacterized protein | ||||
| TrEMBL | A2YAK9 | 1e-55 | A2YAK9_ORYSI; Uncharacterized protein | ||||
| TrEMBL | A3B9K4 | 1e-55 | A3B9K4_ORYSJ; Uncharacterized protein | ||||
| STRING | ONIVA03G22460.1 | 2e-56 | (Oryza nivara) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP604 | 38 | 176 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G50420.1 | 3e-19 | scarecrow-like 3 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




