![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | BGIOSGA023865-PA | ||||||||
| Common Name | OsI_26970 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
|
||||||||
| Family | MYB | ||||||||
| Protein Properties | Length: 152aa MW: 17311.6 Da PI: 7.3841 | ||||||||
| Description | MYB family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Myb_DNA-binding | 57.7 | 2.8e-18 | 14 | 61 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
+g+WT+eEd+ lv +v+++G+g+W++++ + g+ R+ k+c++rw +yl
BGIOSGA023865-PA 14 KGPWTPEEDLVLVSYVQEHGPGNWRAVPTRTGLMRCSKSCRLRWTNYL 61
79********************************************97 PP
| |||||||
| 2 | Myb_DNA-binding | 53 | 7.6e-17 | 67 | 112 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
rg++T +E++l+v++ ++lG++ W++Ia++++ Rt++++k++w+++l
BGIOSGA023865-PA 67 RGNFTDQEEKLIVHLQALLGNR-WAAIASYLP-ERTDNDIKNYWNTHL 112
89********************.*********.************996 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:1.10.10.60 | 4.9E-25 | 5 | 64 | IPR009057 | Homeodomain-like |
| PROSITE profile | PS51294 | 25.358 | 9 | 65 | IPR017930 | Myb domain |
| SuperFamily | SSF46689 | 8.44E-31 | 11 | 108 | IPR009057 | Homeodomain-like |
| SMART | SM00717 | 2.9E-13 | 13 | 63 | IPR001005 | SANT/Myb domain |
| Pfam | PF00249 | 4.7E-17 | 14 | 61 | IPR001005 | SANT/Myb domain |
| CDD | cd00167 | 2.34E-11 | 16 | 61 | No hit | No description |
| Gene3D | G3DSA:1.10.10.60 | 8.2E-25 | 65 | 116 | IPR009057 | Homeodomain-like |
| SMART | SM00717 | 3.2E-16 | 66 | 114 | IPR001005 | SANT/Myb domain |
| PROSITE profile | PS51294 | 20.609 | 66 | 116 | IPR017930 | Myb domain |
| Pfam | PF00249 | 1.5E-15 | 67 | 112 | IPR001005 | SANT/Myb domain |
| CDD | cd00167 | 1.15E-11 | 69 | 112 | No hit | No description |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 152 aa Download sequence Send to blast |
MVRPPCCDKD GVKKGPWTPE EDLVLVSYVQ EHGPGNWRAV PTRTGLMRCS KSCRLRWTNY 60 LRPGIKRGNF TDQEEKLIVH LQALLGNRWA AIASYLPERT DNDIKNYWNT HLKRKLQGGD 120 ETQLSAIESW LFADADGIES GSLLDAAMDY TF |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1gv2_A | 4e-28 | 14 | 116 | 4 | 105 | MYB PROTO-ONCOGENE PROTEIN |
| 1h88_C | 2e-27 | 14 | 116 | 58 | 159 | MYB PROTO-ONCOGENE PROTEIN |
| 1h89_C | 2e-27 | 14 | 116 | 58 | 159 | MYB PROTO-ONCOGENE PROTEIN |
| 1h8a_C | 1e-27 | 12 | 116 | 25 | 128 | MYB TRANSFORMING PROTEIN |
| 1mse_C | 4e-28 | 14 | 116 | 4 | 105 | C-Myb DNA-Binding Domain |
| 1msf_C | 4e-28 | 14 | 116 | 4 | 105 | C-Myb DNA-Binding Domain |
| Search in ModeBase | ||||||
| Expression -- UniGene ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| UniGene ID | E-value | Expressed in | ||||
| Os.100073 | 0.0 | callus| leaf| panicle | ||||
| Os.25588 | 0.0 | callus| leaf| panicle| stem | ||||
| Expression -- Microarray ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | ID | E-value | ||||
| GEO | 152926137 | 0.0 | ||||
| Expression -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| Uniprot | DEVELOPMENTAL STAGE: Expressed in 2-week-old seedlings, in the early stages of development. {ECO:0000269|PubMed:10571865}. | |||||
| Uniprot | TISSUE SPECIFICITY: Expressed in vascular tissues of leaves, hypocotyl and roots. {ECO:0000269|PubMed:24587042}. | |||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription factor that binds specifically to the DNA sequence 5'-AACAAAC-3' (PubMed:19170933). Acts as a positive regulator of hypersensitive cell death (PubMed:10571865, PubMed:12119395). Acts as a positive regulator of salicylic acid synthesis (PubMed:16730712). Regulates very-long-chain fatty acid biosynthesis (PubMed:18326828). Acts cooperatively with BZR2 to promote expression of a subset of brassinosteroids target genes (PubMed:19170933). Transcriptional activity and hypersensitive response control negatively regulated by PLA2-ALPHA and by the Xanthomonas type III effector XopD (AC G9L9K6) (PubMed:20696912, PubMed:21917550). Involved in the regulation of abscisic acid (ABA) signaling (PubMed:22814374). Increased levels of MYB30 can accelerate flowering both in long and short days through the regulation of FT (PubMed:24587042). {ECO:0000269|PubMed:10571865, ECO:0000269|PubMed:12119395, ECO:0000269|PubMed:16730712, ECO:0000269|PubMed:18326828, ECO:0000269|PubMed:19170933, ECO:0000269|PubMed:20696912, ECO:0000269|PubMed:21917550, ECO:0000269|PubMed:22814374, ECO:0000269|PubMed:24587042}. | |||||
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Up-regulated during hypersensitive response, but no expression detected during compatible interaction with pathogens (PubMed:10571865). Specifically induced in the inoculated zone 4 hours post pathogen infection (PubMed:20696912). Up-regulated by jasmonic acid and salicylic acid (PubMed:16463103, PubMed:16730712). Transcriptionally regulated by BZR2 (PubMed:19170933). {ECO:0000269|PubMed:10571865, ECO:0000269|PubMed:16463103, ECO:0000269|PubMed:16730712, ECO:0000269|PubMed:19170933, ECO:0000269|PubMed:20696912}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AK101674 | 0.0 | AK101674.1 Oryza sativa Japonica Group cDNA clone:J033058E05, full insert sequence. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_006658859.1 | 2e-86 | PREDICTED: transcription factor MYB30-like | ||||
| Swissprot | Q9SCU7 | 2e-78 | MYB30_ARATH; Transcription factor MYB30 | ||||
| TrEMBL | B8B4W9 | 1e-110 | B8B4W9_ORYSI; Uncharacterized protein | ||||
| TrEMBL | Q7X8X3 | 1e-110 | Q7X8X3_ORYSJ; Os07g0629000 protein | ||||
| STRING | OS07T0629000-01 | 1e-111 | (Oryza sativa) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP229 | 38 | 296 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT3G28910.1 | 8e-81 | myb domain protein 30 | ||||




