![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | BGIOSGA033733-PA | ||||||||
| Common Name | ILI2, OsI_36643 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
|
||||||||
| Family | bHLH | ||||||||
| Protein Properties | Length: 77aa MW: 8396.73 Da PI: 5.0364 | ||||||||
| Description | bHLH family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | HLH | 27.6 | 5.1e-09 | 3 | 39 | 18 | 54 |
HHHHHHHCTSCCC...TTS-STCHHHHHHHHHHHHHH CS
HLH 18 safeeLrellPkaskapskKlsKaeiLekAveYIksL 54
+ +++L+ +lP++ ++ + K s ae+L++A++YI+ L
BGIOSGA033733-PA 3 ELISKLQAVLPTRGGEANAKASSAEVLQEACRYIRRL 39
789*********88*********************99 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS50888 | 9.553 | 1 | 39 | IPR011598 | Myc-type, basic helix-loop-helix (bHLH) domain |
| SuperFamily | SSF47459 | 4.32E-8 | 2 | 55 | IPR011598 | Myc-type, basic helix-loop-helix (bHLH) domain |
| Pfam | PF00010 | 6.2E-6 | 3 | 39 | IPR011598 | Myc-type, basic helix-loop-helix (bHLH) domain |
| Gene3D | G3DSA:4.10.280.10 | 2.0E-7 | 3 | 53 | IPR011598 | Myc-type, basic helix-loop-helix (bHLH) domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0046983 | Molecular Function | protein dimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 77 aa Download sequence Send to blast |
MAELISKLQA VLPTRGGEAN AKASSAEVLQ EACRYIRRLH READALSERL AELLLLQPSD 60 LAINGADVPD LIRSLLM |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Atypical and probable non DNA-binding bHLH transcription factor that integrates multiple signaling pathways to regulate cell elongation and plant development. {ECO:0000250}. | |||||
| UniProt | Atypical and probable non DNA-binding bHLH transcription factor that integrates multiple signaling pathways to regulate cell elongation and plant development. {ECO:0000250}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | CT833202 | 1e-128 | CT833202.1 Oryza sativa (indica cultivar-group) cDNA clone:OSIGCEA029D09, full insert sequence. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_015616701.1 | 2e-47 | transcription factor ILI2 isoform X2 | ||||
| Swissprot | B8BLA3 | 2e-46 | ILI2_ORYSI; Transcription factor ILI2 | ||||
| Swissprot | Q2R1J3 | 2e-46 | ILI2_ORYSJ; Transcription factor ILI2 | ||||
| TrEMBL | A0A0E0BKZ7 | 3e-46 | A0A0E0BKZ7_9ORYZ; Uncharacterized protein | ||||
| STRING | OGLUM11G18550.1 | 4e-47 | (Oryza glumipatula) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP17004 | 11 | 12 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G26945.1 | 1e-08 | bHLH family protein | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




