PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information? help Back to Top

TF ID

Bathy14g02150

Organism

Taxonomic ID

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; prasinophytes; Mamiellophyceae; Mamiellales; Bathycoccaceae; Bathycoccus

Family

Protein Properties

Length: 70aa MW: 7765.82 Da PI: 4.3094

Description

NF-YB family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Bathy14g02150	genome	ORCAE	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	NF-YB	89.3	4e-28	21	69	1	49
NF-YB 1 vreqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtse 49 vreqdrflPian+srimkk+lPanaki+kdaketvqecvsefisf+tse Bathy14g02150 21 VREQDRFLPIANISRIMKKALPANAKIAKDAKETVQECVSEFISFITSE 69 69*********************************************98 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.10.20.10	4.3E-26	20	69	IPR009072	Histone-fold
SuperFamily	SSF47113	2.99E-17	22	69	IPR009072	Histone-fold
Pfam	PF00808	4.2E-17	27	69	IPR003958	Transcription factor CBF/NF-Y/archaeal histone domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0046982	Molecular Function	protein heterodimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 70 aa Download sequence Send to blast
MPAYNEGEVE IDEDDFKCAA VREQDRFLPI ANISRIMKKA LPANAKIAKD AKETVQECVS 60 EFISFITSE*

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
4g91_B	4e-22	21	69	1	49	Transcription factor HapC (Eurofung)
4g92_B	4e-22	21	69	1	49	Transcription factor HapC (Eurofung)
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters.
UniProt	Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. May regulate the expression of photosynthetic genes, and may be involved in chloroplast and amyloplast development. {ECO:0000269\|PubMed:14617083}.

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	FO082265	1e-114	FO082265.1 Bathycoccus prasinos genomic : Chromosome_14.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_007509217.1	1e-43	predicted protein
Swissprot	O23310	2e-27	NFYB3_ARATH; Nuclear transcription factor Y subunit B-3
Swissprot	Q5QMG3	3e-27	NFYB2_ORYSJ; Nuclear transcription factor Y subunit B-2
TrEMBL	K8ENY2	3e-42	K8ENY2_9CHLO; Uncharacterized protein
STRING	XP_007509217.1	5e-43	(Bathycoccus prasinos)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Chlorophytae	OGCP2023	16	16

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT4G14540.1	7e-30	nuclear factor Y, subunit B3

Link Out ? help Back to Top
Entrez Gene	19011976

Publications ? help Back to Top
Han X, et al. Overexpression of the poplar NF-YB7 transcription factor confers drought tolerance and improves water-use efficiency in Arabidopsis. J. Exp. Bot., 2013. 64(14): p. 4589-601 [PMID:24006421] Hwang YH, et al. Functional conservation of rice OsNF-YB/YC and Arabidopsis AtNF-YB/YC proteins in the regulation of flowering time. Plant Cell Rep., 2016. 35(4): p. 857-65 [PMID:26754793] Hossain MA, et al. Identification of Novel Components of the Unfolded Protein Response in Arabidopsis. Front Plant Sci, 2016. 7: p. 650 [PMID:27242851] Zhao H, et al. The Arabidopsis thaliana Nuclear Factor Y Transcription Factors. Front Plant Sci, 2016. 7: p. 2045 [PMID:28119722]