![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Bostr.0556s0002.1.p | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Boechereae; Boechera
|
||||||||
| Family | G2-like | ||||||||
| Protein Properties | Length: 72aa MW: 8240.6 Da PI: 11.3437 | ||||||||
| Description | G2-like family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | G2-like | 86.8 | 2.1e-27 | 2 | 54 | 2 | 55 |
G2-like 2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
+r++W++ LH++Fv+av+qL G++kA Pk+ilelm+v+gL++++v+SHLQk+R+
Bostr.0556s0002.1.p 2 KRVVWSNALHQQFVNAVNQL-GIDKAKPKRILELMNVPGLSRDNVASHLQKFRM 54
79******************.********************************7 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:1.10.10.60 | 7.5E-27 | 1 | 55 | IPR009057 | Homeodomain-like |
| PROSITE profile | PS51294 | 12.3 | 1 | 57 | IPR017930 | Myb domain |
| SuperFamily | SSF46689 | 8.69E-19 | 2 | 57 | IPR009057 | Homeodomain-like |
| TIGRFAMs | TIGR01557 | 9.6E-25 | 2 | 54 | IPR006447 | Myb domain, plants |
| Pfam | PF00249 | 2.2E-7 | 3 | 52 | IPR001005 | SANT/Myb domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 72 aa Download sequence Send to blast |
MKRVVWSNAL HQQFVNAVNQ LGIDKAKPKR ILELMNVPGL SRDNVASHLQ KFRMCQKGQT 60 QMLERSSSQR Y* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1irz_A | 5e-19 | 3 | 57 | 7 | 61 | ARR10-B |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcriptional activator that binds specifically to the DNA sequence 5'-[AG]GATT-3'. Functions as a response regulator involved in His-to-Asp phosphorelay signal transduction system. Phosphorylation of the Asp residue in the receiver domain activates the ability of the protein to promote the transcription of target genes. Could directly activate some type-A response regulators in response to cytokinins (By similarity). {ECO:0000250}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Bostr.0556s0002.1.p |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AY088149 | 7e-56 | AY088149.1 Arabidopsis thaliana clone 41875 mRNA, complete sequence. | |||
| GenBank | AY099726 | 7e-56 | AY099726.1 Arabidopsis thaliana putative two-component response regulator protein (At2g01760) mRNA, complete cds. | |||
| GenBank | AY128887 | 7e-56 | AY128887.1 Arabidopsis thaliana putative two-component response regulator protein (At2g01760) mRNA, complete cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | NP_001324401.1 | 8e-25 | response regulator 14 | ||||
| Refseq | XP_023638473.1 | 9e-25 | two-component response regulator ARR14 isoform X1 | ||||
| Swissprot | Q8L9Y3 | 1e-25 | ARR14_ARATH; Two-component response regulator ARR14 | ||||
| TrEMBL | A0A1P8B023 | 2e-23 | A0A1P8B023_ARATH; Response regulator 14 | ||||
| TrEMBL | R0H786 | 3e-23 | R0H786_9BRAS; Two-component response regulator | ||||
| STRING | Bostr.0556s0002.1.p | 2e-46 | (Boechera stricta) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM15903 | 7 | 12 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT2G01760.1 | 6e-28 | response regulator 14 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | Bostr.0556s0002.1.p |




