![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Bostr.0556s0540.1.p | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Boechereae; Boechera
|
||||||||
| Family | ZF-HD | ||||||||
| Protein Properties | Length: 101aa MW: 10722.9 Da PI: 7.7389 | ||||||||
| Description | ZF-HD family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | ZF-HD_dimer | 107.1 | 9.9e-34 | 30 | 87 | 3 | 60 |
ZF-HD_dimer 3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreveee 60
+vrY eC+kNhAa++Gg+avDGC+Efm s+geegt aal+CaACgCHR+FHRre e+e
Bostr.0556s0540.1.p 30 TVRYGECQKNHAAAVGGYAVDGCREFMGSQGEEGTLAALTCAACGCHRSFHRREIETE 87
79****************************************************9876 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| ProDom | PD125774 | 4.0E-30 | 1 | 97 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
| Pfam | PF04770 | 4.4E-29 | 31 | 84 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
| TIGRFAMs | TIGR01566 | 8.7E-28 | 32 | 84 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
| PROSITE profile | PS51523 | 24.695 | 33 | 83 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 101 aa Download sequence Send to blast |
MRKRQVVLRR ASPEEPSNSS STASSLTVRT VRYGECQKNH AAAVGGYAVD GCREFMGSQG 60 EEGTLAALTC AACGCHRSFH RREIETEVVC DCNSPPSTGN * |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Inhibits zinc finger homeodomain (ZHD) transcription factors by interacting with them to prevent both their nuclear localization and their DNA-binding properties. Involved in integrating signals from multiple hormones by regulating the expression of specific genes. {ECO:0000269|PubMed:21455630}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Bostr.0556s0540.1.p |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AK221094 | 1e-107 | AK221094.1 Arabidopsis thaliana mRNA for hypothetical protein, complete cds, clone: RAFL22-84-D24. | |||
| GenBank | AP000386 | 1e-107 | AP000386.1 Arabidopsis thaliana genomic DNA, chromosome 3, P1 clone:MLD15. | |||
| GenBank | BT024663 | 1e-107 | BT024663.1 Arabidopsis thaliana unknown protein (At3g28917) mRNA, complete cds. | |||
| GenBank | CP002686 | 1e-107 | CP002686.1 Arabidopsis thaliana chromosome 3, complete sequence. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_018481496.1 | 3e-58 | PREDICTED: mini zinc finger protein 2-like | ||||
| Refseq | XP_018481497.1 | 3e-58 | PREDICTED: mini zinc finger protein 2-like | ||||
| Swissprot | Q9LJW5 | 5e-56 | MIF2_ARATH; Mini zinc finger protein 2 | ||||
| TrEMBL | D7LM58 | 4e-54 | D7LM58_ARALL; Uncharacterized protein | ||||
| STRING | Bostr.0556s0540.1.p | 6e-68 | (Boechera stricta) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM944 | 28 | 114 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT3G28917.1 | 7e-44 | mini zinc finger 2 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | Bostr.0556s0540.1.p |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




