![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Bostr.0568s0498.1.p | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Boechereae; Boechera
|
||||||||
| Family | LBD | ||||||||
| Protein Properties | Length: 187aa MW: 20241.9 Da PI: 7.9012 | ||||||||
| Description | LBD family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | DUF260 | 143.1 | 8.4e-45 | 11 | 109 | 1 | 99 |
DUF260 1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleql 90
+CaaCk+lrrkC ++C++apyfp e+p+kfanvhk+FGasnv+kll++l +++reda++sl+yeAear+rdPvyG+vg i+ lq+q+++l
Bostr.0568s0498.1.p 11 PCAACKFLRRKCMPGCIFAPYFPPEEPHKFANVHKIFGASNVTKLLNELLPHQREDAVNSLAYEAEARVRDPVYGCVGAISYLQRQVHRL 100
7***************************************************************************************** PP
DUF260 91 kaelallke 99
++el+++++
Bostr.0568s0498.1.p 101 QKELDAANA 109
****99876 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS50891 | 28.183 | 10 | 111 | IPR004883 | Lateral organ boundaries, LOB |
| Pfam | PF03195 | 5.0E-44 | 11 | 108 | IPR004883 | Lateral organ boundaries, LOB |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0010199 | Biological Process | organ boundary specification between lateral organs and the meristem | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 187 aa Download sequence Send to blast |
MASSSNSYNS PCAACKFLRR KCMPGCIFAP YFPPEEPHKF ANVHKIFGAS NVTKLLNELL 60 PHQREDAVNS LAYEAEARVR DPVYGCVGAI SYLQRQVHRL QKELDAANAD LAHYGLSTSA 120 AGTPGNVVDL VFQPQPLPSQ QTPPLNPVYR LSGANPVMTQ LPRGTGGSYG TFLPWNDGHD 180 QQGGNM* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 5ly0_A | 5e-65 | 2 | 115 | 2 | 115 | LOB family transfactor Ramosa2.1 |
| 5ly0_B | 5e-65 | 2 | 115 | 2 | 115 | LOB family transfactor Ramosa2.1 |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Not known; ectopic expression of LOB leads to alterations in the size and shape of leaves and floral organs and causes male and female sterility. | |||||
| Binding Motif ? help Back to Top | |||
|---|---|---|---|
| Motif ID | Method | Source | Motif file |
| MP00581 | DAP | Transfer from AT5G63090 | Download |
| |||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Bostr.0568s0498.1.p |
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Positively regulated within the shoot apex by both ASYMMETRIC LEAVES 1 (AS1) and ASYMMETRIC LEAVES 2 (AS2/LBD6) and by KNAT1. {ECO:0000269|PubMed:11934861}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | Retrieve | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AB008265 | 0.0 | AB008265.1 Arabidopsis thaliana genomic DNA, chromosome 5, P1 clone:MDC12. | |||
| GenBank | AB164305 | 0.0 | AB164305.1 Arabidopsis thaliana ASL4 mRNA for ASYMMETRIC LEAVES2-like gene 4 protein, partial cds. | |||
| GenBank | AB473837 | 0.0 | AB473837.1 Arabidopsis thaliana ASL4 mRNA for ASYMMETRIC LEAVES2-like 4 protein, complete cds. | |||
| GenBank | AF447897 | 0.0 | AF447897.1 Arabidopsis thaliana LOBa (LOB) mRNA, complete cds; alternatively spliced. | |||
| GenBank | BT025745 | 0.0 | BT025745.1 Arabidopsis thaliana At5g63090 mRNA, complete cds. | |||
| GenBank | CP002688 | 0.0 | CP002688.1 Arabidopsis thaliana chromosome 5 sequence. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | NP_201114.1 | 1e-134 | Lateral organ boundaries (LOB) domain family protein | ||||
| Refseq | NP_851252.1 | 1e-134 | Lateral organ boundaries (LOB) domain family protein | ||||
| Refseq | NP_851253.1 | 1e-134 | Lateral organ boundaries (LOB) domain family protein | ||||
| Refseq | NP_851254.1 | 1e-134 | Lateral organ boundaries (LOB) domain family protein | ||||
| Swissprot | Q9FML4 | 1e-135 | LOB_ARATH; Protein LATERAL ORGAN BOUNDARIES | ||||
| TrEMBL | A0A178UKE6 | 1e-132 | A0A178UKE6_ARATH; LOB | ||||
| STRING | Bostr.0568s0498.1.p | 1e-137 | (Boechera stricta) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM131 | 28 | 340 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G63090.4 | 1e-124 | LBD family protein | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | Bostr.0568s0498.1.p |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




