![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Bostr.11793s0061.1.p | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Boechereae; Boechera
|
||||||||
| Family | NF-YB | ||||||||
| Protein Properties | Length: 175aa MW: 18939.1 Da PI: 5.9867 | ||||||||
| Description | NF-YB family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NF-YB | 177.8 | 9.9e-56 | 27 | 121 | 1 | 95 |
NF-YB 1 vreqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkk 89
vreqdrflPian+srimk+ lP n+ki+kdaket+qecvsefisfvtseasdkcqrekrktingddllwa+atlGfedy+eplkvyl++
Bostr.11793s0061.1.p 27 VREQDRFLPIANISRIMKRGLPLNGKIAKDAKETMQECVSEFISFVTSEASDKCQREKRKTINGDDLLWAMATLGFEDYIEPLKVYLMR 115
69*************************************************************************************** PP
NF-YB 90 yreleg 95
yre ++
Bostr.11793s0061.1.p 116 YREGDT 121
**9665 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:1.10.20.10 | 2.1E-52 | 25 | 137 | IPR009072 | Histone-fold |
| SuperFamily | SSF47113 | 6.74E-40 | 30 | 149 | IPR009072 | Histone-fold |
| Pfam | PF00808 | 2.5E-27 | 33 | 97 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
| PRINTS | PR00615 | 3.8E-21 | 61 | 79 | No hit | No description |
| PROSITE pattern | PS00685 | 0 | 64 | 80 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
| PRINTS | PR00615 | 3.8E-21 | 80 | 98 | No hit | No description |
| PRINTS | PR00615 | 3.8E-21 | 99 | 117 | No hit | No description |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| GO:0046982 | Molecular Function | protein heterodimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 175 aa Download sequence Send to blast |
MSESQTGGGG GGSHESGGDQ SPRSLNVREQ DRFLPIANIS RIMKRGLPLN GKIAKDAKET 60 MQECVSEFIS FVTSEASDKC QREKRKTING DDLLWAMATL GFEDYIEPLK VYLMRYREGD 120 TKGSGKGGES SGKRDGQPSQ VSQFSQLPQQ GSFSQGPYGN SQASNMMVQM PGTE* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 4g91_B | 2e-47 | 27 | 118 | 1 | 92 | Transcription factor HapC (Eurofung) |
| 4g92_B | 2e-47 | 27 | 118 | 1 | 92 | Transcription factor HapC (Eurofung) |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Bostr.11793s0061.1.p |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AK176827 | 0.0 | AK176827.1 Arabidopsis thaliana mRNA for transcription factor NF-Y, CCAAT-binding - like protein, complete cds, clone: RAFL25-38-H16. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | NP_001327562.1 | 1e-110 | nuclear factor Y, subunit B10 | ||||
| Refseq | NP_190902.2 | 1e-110 | nuclear factor Y, subunit B10 | ||||
| Swissprot | Q67XJ2 | 1e-111 | NFYBA_ARATH; Nuclear transcription factor Y subunit B-10 | ||||
| TrEMBL | A0A178VNV1 | 1e-109 | A0A178VNV1_ARATH; NF-YB10 | ||||
| STRING | Bostr.11793s0061.1.p | 1e-125 | (Boechera stricta) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM1480 | 27 | 94 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT3G53340.1 | 9e-93 | nuclear factor Y, subunit B10 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | Bostr.11793s0061.1.p |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




