![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Bostr.9638s0128.1.p | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Boechereae; Boechera
|
||||||||
| Family | NF-YC | ||||||||
| Protein Properties | Length: 111aa MW: 12966 Da PI: 6.6609 | ||||||||
| Description | NF-YC family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NF-YC | 66.8 | 3.7e-21 | 1 | 44 | 38 | 81 |
NF-YC 38 misaeaPvllskacelfileltlrswlhaeenkrrtlkksdiaa 81
+is +aP+l+skace+fileltlr+w+h+++++r+t++++di+
Bostr.9638s0128.1.p 1 KISWDAPALFSKACEYFILELTLRTWMHTQSCTRQTIRRCDIFH 44
5999**************************************86 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:1.10.20.10 | 9.5E-13 | 1 | 42 | IPR009072 | Histone-fold |
| SuperFamily | SSF47113 | 2.29E-9 | 1 | 47 | IPR009072 | Histone-fold |
| Pfam | PF00808 | 9.4E-6 | 1 | 42 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0046982 | Molecular Function | protein heterodimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 111 aa Download sequence Send to blast |
KISWDAPALF SKACEYFILE LTLRTWMHTQ SCTRQTIRRC DIFHSRPPHC VTHQGVPRPA 60 EIVLPDMNVL VYMNQNKQEN LMDEHFINKG FDLNSDIQVV FFELLFTQPL * |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. {ECO:0000250}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Bostr.9638s0128.1.p |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AB005247 | 6e-45 | AB005247.2 Arabidopsis thaliana genomic DNA, chromosome 5, P1 clone:MXA21. | |||
| GenBank | AB493768 | 6e-45 | AB493768.1 Arabidopsis thaliana At5g38140 mRNA for hypothetical protein, partial cds, clone: RAAt5g38140. | |||
| GenBank | BT021919 | 6e-45 | BT021919.1 Arabidopsis thaliana At5g38140 mRNA, complete cds. | |||
| GenBank | BT025775 | 6e-45 | BT025775.1 Arabidopsis thaliana At5g38140 mRNA, complete cds. | |||
| GenBank | CP002688 | 6e-45 | CP002688.1 Arabidopsis thaliana chromosome 5 sequence. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_020874803.1 | 5e-44 | nuclear transcription factor Y subunit C-10 | ||||
| Swissprot | Q58CM8 | 2e-41 | NFYCA_ARATH; Nuclear transcription factor Y subunit C-10 | ||||
| TrEMBL | D7MK40 | 6e-49 | D7MK40_ARALL; Uncharacterized protein | ||||
| STRING | Bostr.9638s0128.1.p | 1e-78 | (Boechera stricta) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM16422 | 11 | 12 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G38140.1 | 9e-44 | nuclear factor Y, subunit C12 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | Bostr.9638s0128.1.p |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




