![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Bradi2g12590.1.p | ||||||||
| Common Name | BRADI_2g12590, LOC100827983 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
|
||||||||
| Family | GATA | ||||||||
| Protein Properties | Length: 132aa MW: 14295.1 Da PI: 9.0256 | ||||||||
| Description | GATA family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | GATA | 57.8 | 1.5e-18 | 21 | 54 | 1 | 34 |
GATA 1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkg 34
C+ C+tt+Tp+WR gp g ++LCnaCG++yrkk+
Bradi2g12590.1.p 21 CVECRTTTTPMWRGGPTGRRSLCNACGIRYRKKK 54
********************************97 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS50114 | 12.861 | 15 | 51 | IPR000679 | Zinc finger, GATA-type |
| SMART | SM00401 | 6.1E-16 | 15 | 65 | IPR000679 | Zinc finger, GATA-type |
| SuperFamily | SSF57716 | 1.28E-13 | 18 | 58 | No hit | No description |
| Gene3D | G3DSA:3.30.50.10 | 1.9E-16 | 19 | 56 | IPR013088 | Zinc finger, NHR/GATA-type |
| CDD | cd00202 | 4.88E-13 | 20 | 56 | No hit | No description |
| Pfam | PF00320 | 2.1E-16 | 21 | 55 | IPR000679 | Zinc finger, GATA-type |
| PROSITE pattern | PS00344 | 0 | 21 | 46 | IPR000679 | Zinc finger, GATA-type |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0030154 | Biological Process | cell differentiation | ||||
| GO:0045944 | Biological Process | positive regulation of transcription from RNA polymerase II promoter | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0005667 | Cellular Component | transcription factor complex | ||||
| GO:0000977 | Molecular Function | RNA polymerase II regulatory region sequence-specific DNA binding | ||||
| GO:0001085 | Molecular Function | RNA polymerase II transcription factor binding | ||||
| GO:0001228 | Molecular Function | transcriptional activator activity, RNA polymerase II transcription regulatory region sequence-specific binding | ||||
| GO:0003682 | Molecular Function | chromatin binding | ||||
| GO:0008270 | Molecular Function | zinc ion binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 132 aa Download sequence Send to blast |
MGSSDRKVDG IGVVEEGRRS CVECRTTTTP MWRGGPTGRR SLCNACGIRY RKKKRQDLSL 60 DQKEPPPRQQ QHNGEEAITA EVKDSTSNSN SSSGSSNLQV VQERKLLMGV EEAALLLMTL 120 SSPPPSTLLH G* |
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Bradi2g12590.1.p |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | FP096799 | 1e-58 | FP096799.1 Phyllostachys edulis cDNA clone: bphylf042b12, full insert sequence. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_003567660.1 | 3e-92 | GATA transcription factor 23 | ||||
| TrEMBL | I1HF65 | 8e-91 | I1HF65_BRADI; Uncharacterized protein | ||||
| STRING | BRADI2G12590.1 | 1e-91 | (Brachypodium distachyon) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP6721 | 28 | 54 | Representative plant | OGRP68 | 17 | 287 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G26930.1 | 1e-17 | GATA transcription factor 23 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | Bradi2g12590.1.p |
| Entrez Gene | 100827983 |




