![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Bradi2g32792.1.p | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
|
||||||||
| Family | GATA | ||||||||
| Protein Properties | Length: 84aa MW: 9233.34 Da PI: 8.3624 | ||||||||
| Description | GATA family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | GATA | 41.8 | 1.5e-13 | 2 | 36 | 1 | 35 |
GATA 1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35
C++C t kT +WR g + ++ LCnaCG++ k+g+
Bradi2g32792.1.p 2 CQHCFTRKTRQWRLGTREKSPLCNACGIRLIKNGE 36
****************98888********988876 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SuperFamily | SSF57716 | 5.23E-12 | 1 | 58 | No hit | No description |
| PROSITE profile | PS50114 | 9.605 | 1 | 39 | IPR000679 | Zinc finger, GATA-type |
| PROSITE pattern | PS00344 | 0 | 2 | 27 | IPR000679 | Zinc finger, GATA-type |
| Gene3D | G3DSA:3.30.50.10 | 7.5E-11 | 2 | 39 | IPR013088 | Zinc finger, NHR/GATA-type |
| Pfam | PF00320 | 2.7E-11 | 2 | 36 | IPR000679 | Zinc finger, GATA-type |
| CDD | cd00202 | 1.93E-11 | 2 | 39 | No hit | No description |
| SMART | SM00401 | 4.1E-5 | 2 | 47 | IPR000679 | Zinc finger, GATA-type |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0008270 | Molecular Function | zinc ion binding | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 84 aa Download sequence Send to blast |
MCQHCFTRKT RQWRLGTREK SPLCNACGIR LIKNGELHPE YHLAASETFV GAIHSNIHRR 60 VLELHSENQG TDGSSSSTGE TAA* |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcriptional activator that specifically binds 5'-GATA-3' or 5'-GAT-3' motifs within gene promoters. May be involved in the regulation of some light-responsive genes (By similarity). {ECO:0000250}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Bradi2g32792.1.p |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_003562098.1 | 1e-18 | GATA transcription factor 4 | ||||
| Swissprot | Q9SV30 | 6e-18 | GATA8_ARATH; GATA transcription factor 8 | ||||
| TrEMBL | A0A2K2DBH4 | 4e-55 | A0A2K2DBH4_BRADI; Uncharacterized protein | ||||
| STRING | BRADI1G75420.1 | 5e-18 | (Brachypodium distachyon) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP1417 | 33 | 108 | Representative plant | OGRP68 | 17 | 287 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G25830.1 | 3e-20 | GATA transcription factor 12 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | Bradi2g32792.1.p |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




