PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Bradi2g32910.2.p

Common Name

BRADI_2g32910, LOC100824190

Organism

Brachypodium distachyon

Taxonomic ID

15368

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium

Family

MIKC_MADS

Protein Properties

Length: 315aa MW: 36070.5 Da PI: 9.3825

Description

MIKC_MADS family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Bradi2g32910.2.p	genome	JGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SRF-TF	99.3	1.5e-31	91	141	1	51
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 krien++nrqvtf+kRrng+lKKA+ELSvLCdaeva+i+fss+g+lyeys+ Bradi2g32910.2.p 91 KRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYSN 141 79***********************************************95 PP
2	K-box	102.3	6.3e-34	159	255	4	100
K-box 4 ssgks.leeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLr 95 s++ ++e +a+++qqe+akL+ +i nLq+++R l+Ge++ ++s+++L+qLe +L+k+l kiR++Knell+++ie++q++e elq++n +Lr Bradi2g32910.2.p 159 SNT-GtVAEINAQHYQQESAKLRHQITNLQNSNRTLIGESMATMSHRDLKQLEGRLDKGLGKIRARKNELLCAEIEYMQRREMELQNDNLYLR 250 333.349999********************************************************************************* PP K-box 96 kklee 100 +k++e Bradi2g32910.2.p 251 SKVAE 255 986 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Pfam	PF08639	1.2E-5	5	215	IPR013948	DNA replication regulator Sld3
SMART	SM00432	8.8E-42	83	142	IPR002100	Transcription factor, MADS-box
PROSITE profile	PS50066	33.88	83	143	IPR002100	Transcription factor, MADS-box
SuperFamily	SSF55455	1.03E-32	84	156	IPR002100	Transcription factor, MADS-box
CDD	cd00265	9.25E-44	84	157	No hit	No description
PROSITE pattern	PS00350	0	85	139	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	2.2E-32	85	105	IPR002100	Transcription factor, MADS-box
Pfam	PF00319	1.3E-26	92	139	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	2.2E-32	105	120	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	2.2E-32	120	141	IPR002100	Transcription factor, MADS-box
Pfam	PF01486	2.0E-25	168	253	IPR002487	Transcription factor, K-box
PROSITE profile	PS51297	14.531	169	259	IPR002487	Transcription factor, K-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0090376	Biological Process	seed trichome differentiation
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0046983	Molecular Function	protein dimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 315 aa Download sequence Send to blast
MALLLGGEIA RFPARGRDSA RDIYSLRKPQ KERHHTREEM EHSLTFSSHL QRIVQEVAAQ 60 EQPVKESDSP GSGSGSAGAS EKMGRGRIEI KRIENTTNRQ VTFCKRRNGL LKKAYELSVL 120 CDAEVALIVF SSRGRLYEYS NNSVKATIER YKKATSDTSN TGTVAEINAQ HYQQESAKLR 180 HQITNLQNSN RTLIGESMAT MSHRDLKQLE GRLDKGLGKI RARKNELLCA EIEYMQRREM 240 ELQNDNLYLR SKVAENERGQ QQTLNMMGAA STSDQYEQNM IHCDPRNFLQ FNIMQQPQYY 300 QQQEDRKAYD SVER*

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1tqe_P	7e-20	83	151	1	69	Myocyte-specific enhancer factor 2B
1tqe_Q	7e-20	83	151	1	69	Myocyte-specific enhancer factor 2B
1tqe_R	7e-20	83	151	1	69	Myocyte-specific enhancer factor 2B
1tqe_S	7e-20	83	151	1	69	Myocyte-specific enhancer factor 2B
5f28_A	8e-20	83	151	1	69	MEF2C
5f28_B	8e-20	83	151	1	69	MEF2C
5f28_C	8e-20	83	151	1	69	MEF2C
5f28_D	8e-20	83	151	1	69	MEF2C
6byy_A	8e-20	83	151	1	69	MEF2 CHIMERA
6byy_B	8e-20	83	151	1	69	MEF2 CHIMERA
6byy_C	8e-20	83	151	1	69	MEF2 CHIMERA
6byy_D	8e-20	83	151	1	69	MEF2 CHIMERA
6bz1_A	1e-19	83	151	1	69	MEF2 CHIMERA
6bz1_B	1e-19	83	151	1	69	MEF2 CHIMERA
6c9l_A	7e-20	83	151	1	69	Myocyte-specific enhancer factor 2B
6c9l_B	7e-20	83	151	1	69	Myocyte-specific enhancer factor 2B
6c9l_C	7e-20	83	151	1	69	Myocyte-specific enhancer factor 2B
6c9l_D	7e-20	83	151	1	69	Myocyte-specific enhancer factor 2B
6c9l_E	7e-20	83	151	1	69	Myocyte-specific enhancer factor 2B
6c9l_F	7e-20	83	151	1	69	Myocyte-specific enhancer factor 2B
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Probable transcription factor involved in the development of floral organs. Acts as a C-class protein in association with MADS3. Involved in the control of lodicule number (whorl 2), stamen specification (whorl 3), floral meristem determinacy and regulation of the carpel morphogenesis (whorl 4). Plays a more predominant role in floral meristem determinacy than MADS3. {ECO:0000269\|PubMed:16326928}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Bradi2g32910.2.p

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	KF469313	0.0	KF469313.1 Brachypodium distachyon MADS-box transcription factor 18 mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_010230317.1	0.0	MADS-box transcription factor 58-like isoform X3
Swissprot	Q2V0P1	1e-142	MAD58_ORYSJ; MADS-box transcription factor 58
TrEMBL	A0A0Q3G9C1	0.0	A0A0Q3G9C1_BRADI; Uncharacterized protein
STRING	BRADI2G32910.1	0.0	(Brachypodium distachyon)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Monocots	OGMP649	37	144
Representative plant	OGRP16	17	761

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT4G18960.1	2e-99	MIKC_MADS family protein

Link Out ? help Back to Top
Phytozome	Bradi2g32910.2.p
Entrez Gene	100824190

Publications ? help Back to Top
Kikuchi S, et al. Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice. Science, 2003. 301(5631): p. 376-9 [PMID:12869764] Cheng CH, et al. A fine physical map of the rice chromosome 5. Mol. Genet. Genomics, 2005. 274(4): p. 337-45 [PMID:16261349] Li H, et al. Rice MADS6 interacts with the floral homeotic genes SUPERWOMAN1, MADS3, MADS58, MADS13, and DROOPING LEAF in specifying floral organ identities and meristem fate. Plant Cell, 2011. 23(7): p. 2536-52 [PMID:21784949] Sato H,Yoshida K,Mitsuda N,Ohme-Takagi M,Takamizo T Male-sterile and cleistogamous phenotypes in tall fescue induced by chimeric repressors of SUPERWOMAN1 and OsMADS58. Plant Sci., 2012. 183: p. 183-9 [PMID:22195592] Yun D, et al. OsMADS16 genetically interacts with OsMADS3 and OsMADS58 in specifying floral patterning in rice. Mol Plant, 2013. 6(3): p. 743-56 [PMID:23300256] Wei B, et al. Genome-wide analysis of the MADS-box gene family in Brachypodium distachyon. PLoS ONE, 2014. 9(1): p. e84781 [PMID:24454749] Yan D, et al. Curved chimeric palea 1 encoding an EMF1-like protein maintains epigenetic repression of OsMADS58 in rice palea development. Plant J., 2015. 82(1): p. 12-24 [PMID:25647350] Zheng M, et al. DEFORMED FLORAL ORGAN1 (DFO1) regulates floral organ identity by epigenetically repressing the expression of OsMADS58 in rice (Oryza sativa). New Phytol., 2015. 206(4): p. 1476-90 [PMID:25675970] Chen R, et al. A Gene Expression Profiling of Early Rice Stamen Development that Reveals Inhibition of Photosynthetic Genes by OsMADS58. Mol Plant, 2015. 8(7): p. 1069-89 [PMID:25684654] Hu Y, et al. Interactions of OsMADS1 with Floral Homeotic Genes in Rice Flower Development. Mol Plant, 2015. 8(9): p. 1366-84 [PMID:25917758]