![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Bradi2g59119.2.p | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
|
||||||||
| Family | M-type_MADS | ||||||||
| Protein Properties | Length: 192aa MW: 21348.1 Da PI: 10.7104 | ||||||||
| Description | M-type_MADS family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | SRF-TF | 79.6 | 2.1e-25 | 67 | 116 | 2 | 51 |
---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
SRF-TF 2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
rie+ + rqv fskRr g++KKA+EL LCdaeva+++fs+ gklyeyss
Bradi2g59119.2.p 67 RIEDRTSRQVRFSKRRSGLFKKAFELALLCDAEVALLVFSPAGKLYEYSS 116
8***********************************************96 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS50066 | 28.959 | 58 | 118 | IPR002100 | Transcription factor, MADS-box |
| SMART | SM00432 | 2.0E-33 | 58 | 117 | IPR002100 | Transcription factor, MADS-box |
| CDD | cd00265 | 1.03E-36 | 59 | 133 | No hit | No description |
| SuperFamily | SSF55455 | 3.4E-28 | 60 | 134 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 3.0E-27 | 60 | 80 | IPR002100 | Transcription factor, MADS-box |
| Pfam | PF00319 | 7.7E-25 | 67 | 114 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 3.0E-27 | 80 | 95 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 3.0E-27 | 95 | 116 | IPR002100 | Transcription factor, MADS-box |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| GO:0046983 | Molecular Function | protein dimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 192 aa Download sequence Send to blast |
MSSRPSPRTG PSPPPLPSVL PSPALPGLPR KRGTERDRER SGRRCVAART EEARSVMVRR 60 GRVELRRIED RTSRQVRFSK RRSGLFKKAF ELALLCDAEV ALLVFSPAGK LYEYSSSLSI 120 EGTYDRYQQF AGAVRNTYQG GASTSNDEDP SNLQSRLREI TAWSVHNNAD NADASNLEKL 180 EKLLTDAKRV L* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 3kov_A | 2e-16 | 60 | 117 | 2 | 59 | Myocyte-specific enhancer factor 2A |
| 3kov_B | 2e-16 | 60 | 117 | 2 | 59 | Myocyte-specific enhancer factor 2A |
| 3kov_I | 2e-16 | 60 | 117 | 2 | 59 | Myocyte-specific enhancer factor 2A |
| 3kov_J | 2e-16 | 60 | 117 | 2 | 59 | Myocyte-specific enhancer factor 2A |
| 3p57_A | 2e-16 | 60 | 117 | 2 | 59 | Myocyte-specific enhancer factor 2A |
| 3p57_B | 2e-16 | 60 | 117 | 2 | 59 | Myocyte-specific enhancer factor 2A |
| 3p57_C | 2e-16 | 60 | 117 | 2 | 59 | Myocyte-specific enhancer factor 2A |
| 3p57_D | 2e-16 | 60 | 117 | 2 | 59 | Myocyte-specific enhancer factor 2A |
| 3p57_I | 2e-16 | 60 | 117 | 2 | 59 | Myocyte-specific enhancer factor 2A |
| 3p57_J | 2e-16 | 60 | 117 | 2 | 59 | Myocyte-specific enhancer factor 2A |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Probable transcription factor involved in the regulation of flowering time under short day (SD) conditions. Functions as promoter of flowering under SD conditions, upstream of EHD1, HD3A and MADS14, but downstream of GIGANTEA (GI). May transmit a SD promotion signal from GI to EHD1. Functions independently of MADS50 to control flowering time. {ECO:0000269|PubMed:17951465}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Bradi2g59119.2.p |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | KF469333 | 0.0 | KF469333.1 Brachypodium distachyon MADS-box transcription factor 39 mRNA, complete cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | NP_001288309.1 | 6e-94 | agamous-like MADS-box protein AGL14-like | ||||
| Swissprot | Q9XJ61 | 4e-66 | MAD51_ORYSJ; MADS-box transcription factor 51 | ||||
| TrEMBL | A0A2K2DGU4 | 1e-134 | A0A2K2DGU4_BRADI; Uncharacterized protein | ||||
| TrEMBL | A0A2K2DGU6 | 1e-135 | A0A2K2DGU6_BRADI; Uncharacterized protein | ||||
| STRING | BRADI2G59120.2 | 2e-93 | (Brachypodium distachyon) | ||||
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT4G11880.1 | 9e-32 | AGAMOUS-like 14 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | Bradi2g59119.2.p |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




