![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Bradi3g22297.2.p | ||||||||
| Common Name | BRADI_3g22297 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
|
||||||||
| Family | G2-like | ||||||||
| Protein Properties | Length: 159aa MW: 17702.2 Da PI: 9.4943 | ||||||||
| Description | G2-like family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | G2-like | 105.4 | 3.2e-33 | 36 | 90 | 1 | 55 |
G2-like 1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
kprlrWt +LH+rFv+a++qLGG++kAtPktil++m+vkgLtl h+kSHLQkYRl
Bradi3g22297.2.p 36 KPRLRWTADLHDRFVDAIAQLGGPDKATPKTILRTMGVKGLTLFHLKSHLQKYRL 90
79****************************************************8 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:1.10.10.60 | 1.3E-31 | 33 | 91 | IPR009057 | Homeodomain-like |
| PROSITE profile | PS51294 | 11.098 | 33 | 93 | IPR017930 | Myb domain |
| TIGRFAMs | TIGR01557 | 3.8E-25 | 36 | 91 | IPR006447 | Myb domain, plants |
| SuperFamily | SSF46689 | 6.45E-17 | 36 | 92 | IPR009057 | Homeodomain-like |
| Pfam | PF00249 | 4.7E-8 | 38 | 89 | IPR001005 | SANT/Myb domain |
| Pfam | PF14379 | 5.7E-7 | 131 | 152 | IPR025756 | MYB-CC type transcription factor, LHEQLE-containing domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 159 aa Download sequence Send to blast |
MFPGLIHHHH QHAADDAPRG HGGGSAPSLV LTADPKPRLR WTADLHDRFV DAIAQLGGPD 60 KATPKTILRT MGVKGLTLFH LKSHLQKYRL GKQSGKEITE QSKDGSYLME AQSGINLSPR 120 IPIPDVEESQ EVKEALREQM EVQRRLHEQV KTMQHPYV* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 6j4r_A | 2e-19 | 36 | 92 | 1 | 57 | Protein PHOSPHATE STARVATION RESPONSE 1 |
| 6j4r_B | 2e-19 | 36 | 92 | 1 | 57 | Protein PHOSPHATE STARVATION RESPONSE 1 |
| 6j4r_C | 2e-19 | 36 | 92 | 1 | 57 | Protein PHOSPHATE STARVATION RESPONSE 1 |
| 6j4r_D | 2e-19 | 36 | 92 | 1 | 57 | Protein PHOSPHATE STARVATION RESPONSE 1 |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcriptional activator (PubMed:26586833). Acts redundantly with PHR1 as a key component of the central regulatory system controlling transcriptional responses to Pi starvation (PubMed:26586833). Binds in a sequence-specific manner to phosphate starvation-regulated promoters (PubMed:26586833). {ECO:0000269|PubMed:26586833}. | |||||
| UniProt | Transcriptional activator (PubMed:26586833). Probable component of the central regulatory system controlling transcriptional responses to Pi starvation (PubMed:26586833). Binds in a sequence-specific manner to phosphate starvation-regulated promoters (PubMed:26586833). Required for female gametophyte development and function (PubMed:15634699). {ECO:0000269|PubMed:15634699, ECO:0000269|PubMed:26586833}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Bradi3g22297.2.p |
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Up-regulated in roots by low Pi. {ECO:0000269|PubMed:26586833}. | |||||
| UniProt | INDUCTION: Up-regulated in roots by low Pi. {ECO:0000269|PubMed:26586833}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | BT039053 | 1e-116 | BT039053.1 Zea mays full-length cDNA clone ZM_BFb0367F20 mRNA, complete cds. | |||
| GenBank | JX469981 | 1e-116 | JX469981.1 Zea mays subsp. mays clone UT3341 G2-like transcription factor mRNA, partial cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_003573786.1 | 1e-108 | protein PHR1-LIKE 2 | ||||
| Swissprot | Q8LAJ7 | 1e-53 | PHL3_ARATH; Protein PHR1-LIKE 3 | ||||
| Swissprot | Q94A57 | 1e-53 | PHL2_ARATH; Protein PHR1-LIKE 2 | ||||
| TrEMBL | A0A0Q3FAD2 | 1e-112 | A0A0Q3FAD2_BRADI; Uncharacterized protein | ||||
| STRING | BRADI3G22297.1 | 1e-107 | (Brachypodium distachyon) | ||||
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT4G13640.2 | 2e-56 | G2-like family protein | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | Bradi3g22297.2.p |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




