![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Brast01G030100.1.p | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
|
||||||||
| Family | NF-YB | ||||||||
| Protein Properties | Length: 123aa MW: 13345 Da PI: 10.3748 | ||||||||
| Description | NF-YB family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NF-YB | 108 | 5.9e-34 | 1 | 79 | 17 | 95 |
NF-YB 17 mkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyreleg 95
mk +lPa+ak+sk ake +qec++ef++fvt+eas++c+re+rkt++gdd+++a+ +lG+++y++++ yl+++re+e+
Brast01G030100.1.p 1 MKGALPAEAKVSKRAKEAIQECATEFVAFVTGEASQRCRRERRKTVSGDDVCHAMRSLGLDHYAAAMARYLQRHREAEE 79
899*************************************************************************985 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:1.10.20.10 | 6.0E-32 | 1 | 88 | IPR009072 | Histone-fold |
| Pfam | PF00808 | 3.8E-15 | 1 | 55 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
| SuperFamily | SSF47113 | 1.59E-24 | 1 | 92 | IPR009072 | Histone-fold |
| PRINTS | PR00615 | 4.3E-11 | 19 | 37 | No hit | No description |
| PRINTS | PR00615 | 4.3E-11 | 38 | 56 | No hit | No description |
| PRINTS | PR00615 | 4.3E-11 | 57 | 75 | No hit | No description |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0046982 | Molecular Function | protein heterodimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 123 aa Download sequence Send to blast |
MKGALPAEAK VSKRAKEAIQ ECATEFVAFV TGEASQRCRR ERRKTVSGDD VCHAMRSLGL 60 DHYAAAMARY LQRHREAEEL AAQINGRSGG FGQQIDVRAQ LSSVSSRSRA PGSSETKHLG 120 RN* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 4g91_B | 6e-28 | 1 | 76 | 17 | 92 | Transcription factor HapC (Eurofung) |
| 4g92_B | 6e-28 | 1 | 76 | 17 | 92 | Transcription factor HapC (Eurofung) |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Brast01G030100.1.p |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_024315117.1 | 6e-62 | nuclear transcription factor Y subunit B-4-like | ||||
| Swissprot | O82248 | 4e-32 | NFYB5_ARATH; Nuclear transcription factor Y subunit B-5 | ||||
| TrEMBL | I1HUZ2 | 1e-60 | I1HUZ2_BRADI; Uncharacterized protein | ||||
| STRING | BRADI2G60030.1 | 2e-61 | (Brachypodium distachyon) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP2917 | 38 | 87 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT2G47810.1 | 3e-34 | nuclear factor Y, subunit B5 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | Brast01G030100.1.p |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




