![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Brast06G133300.1.p | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
|
||||||||
| Family | M-type_MADS | ||||||||
| Protein Properties | Length: 170aa MW: 18726.3 Da PI: 10.8394 | ||||||||
| Description | M-type_MADS family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | SRF-TF | 68.5 | 6.2e-22 | 13 | 60 | 2 | 49 |
---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEE CS
SRF-TF 2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyey 49
+i ++s+rqvtfskRr g++KKA+EL+ LC+a+ a+++fs+ g+ + +
Brast06G133300.1.p 13 PIGDTSRRQVTFSKRRSGLFKKASELCALCGADLALVVFSPAGRAFAF 60
5889**************************************987665 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS50066 | 25.203 | 4 | 64 | IPR002100 | Transcription factor, MADS-box |
| SMART | SM00432 | 4.5E-27 | 4 | 63 | IPR002100 | Transcription factor, MADS-box |
| SuperFamily | SSF55455 | 4.45E-25 | 5 | 77 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 3.7E-19 | 6 | 26 | IPR002100 | Transcription factor, MADS-box |
| Pfam | PF00319 | 1.3E-23 | 14 | 60 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 3.7E-19 | 26 | 41 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 3.7E-19 | 41 | 62 | IPR002100 | Transcription factor, MADS-box |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| GO:0046983 | Molecular Function | protein dimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 170 aa Download sequence Send to blast |
MATRGRQRIE IRPIGDTSRR QVTFSKRRSG LFKKASELCA LCGADLALVV FSPAGRAFAF 60 GNPSVDHVLG RHGGAPPLLV LDERAERDAA AATRTELEEA KARVGAEQAR LGAVEEKVRL 120 AMAGRRFYWE ADVEALGEAE LREFARALIR LRDDVRRREN ALLSQSNNR* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1tqe_P | 8e-16 | 5 | 72 | 2 | 69 | Myocyte-specific enhancer factor 2B |
| 1tqe_Q | 8e-16 | 5 | 72 | 2 | 69 | Myocyte-specific enhancer factor 2B |
| 1tqe_R | 8e-16 | 5 | 72 | 2 | 69 | Myocyte-specific enhancer factor 2B |
| 1tqe_S | 8e-16 | 5 | 72 | 2 | 69 | Myocyte-specific enhancer factor 2B |
| 6c9l_A | 8e-16 | 5 | 72 | 2 | 69 | Myocyte-specific enhancer factor 2B |
| 6c9l_B | 8e-16 | 5 | 72 | 2 | 69 | Myocyte-specific enhancer factor 2B |
| 6c9l_C | 8e-16 | 5 | 72 | 2 | 69 | Myocyte-specific enhancer factor 2B |
| 6c9l_D | 8e-16 | 5 | 72 | 2 | 69 | Myocyte-specific enhancer factor 2B |
| 6c9l_E | 8e-16 | 5 | 72 | 2 | 69 | Myocyte-specific enhancer factor 2B |
| 6c9l_F | 8e-16 | 5 | 72 | 2 | 69 | Myocyte-specific enhancer factor 2B |
| Search in ModeBase | ||||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Brast06G133300.1.p |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | KF469339 | 1e-114 | KF469339.1 Brachypodium distachyon MADS-box transcription factor 45 mRNA, complete cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | NP_001288318.1 | 5e-83 | agamous-like MADS-box protein AGL61-like | ||||
| TrEMBL | A0A0Q3KYP4 | 2e-81 | A0A0Q3KYP4_BRADI; Uncharacterized protein | ||||
| TrEMBL | I1GUH5 | 1e-81 | I1GUH5_BRADI; MADS-box transcription factor 45 | ||||
| STRING | BRADI1G27900.1 | 2e-82 | (Brachypodium distachyon) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP2833 | 30 | 88 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT2G24840.1 | 1e-28 | AGAMOUS-like 61 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | Brast06G133300.1.p |




