![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Bv1_012640_hnhs.t3 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Chenopodiaceae; Betoideae; Beta
|
||||||||
| Family | M-type_MADS | ||||||||
| Protein Properties | Length: 72aa MW: 8379.8 Da PI: 10.3228 | ||||||||
| Description | M-type_MADS family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | SRF-TF | 102.3 | 1.8e-32 | 9 | 59 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
krien++nrqvtf+kRrng+lKKA+ELSvLCdaeva+i+fss+g++ye+s+
Bv1_012640_hnhs.t3 9 KRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRVYEFSN 59
79***********************************************95 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SMART | SM00432 | 1.9E-42 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
| PROSITE profile | PS50066 | 33.936 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
| SuperFamily | SSF55455 | 4.45E-31 | 2 | 66 | IPR002100 | Transcription factor, MADS-box |
| CDD | cd00265 | 8.25E-39 | 2 | 60 | No hit | No description |
| PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 2.0E-33 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
| Pfam | PF00319 | 6.4E-28 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 2.0E-33 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 2.0E-33 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0048481 | Biological Process | plant ovule development | ||||
| GO:0080155 | Biological Process | regulation of double fertilization forming a zygote and endosperm | ||||
| GO:0090376 | Biological Process | seed trichome differentiation | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0046983 | Molecular Function | protein dimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 72 aa Download sequence Send to blast |
MGRGKIEIKR IENTTNRQVT FCKRRNGLLK KAYELSVLCD AEVALIVFSS RGRVYEFSNN 60 KYIYSLLNSL LF |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1tqe_P | 2e-20 | 1 | 60 | 1 | 60 | Myocyte-specific enhancer factor 2B |
| 1tqe_Q | 2e-20 | 1 | 60 | 1 | 60 | Myocyte-specific enhancer factor 2B |
| 1tqe_R | 2e-20 | 1 | 60 | 1 | 60 | Myocyte-specific enhancer factor 2B |
| 1tqe_S | 2e-20 | 1 | 60 | 1 | 60 | Myocyte-specific enhancer factor 2B |
| 6c9l_A | 2e-20 | 1 | 60 | 1 | 60 | Myocyte-specific enhancer factor 2B |
| 6c9l_B | 2e-20 | 1 | 60 | 1 | 60 | Myocyte-specific enhancer factor 2B |
| 6c9l_C | 2e-20 | 1 | 60 | 1 | 60 | Myocyte-specific enhancer factor 2B |
| 6c9l_D | 2e-20 | 1 | 60 | 1 | 60 | Myocyte-specific enhancer factor 2B |
| 6c9l_E | 2e-20 | 1 | 60 | 1 | 60 | Myocyte-specific enhancer factor 2B |
| 6c9l_F | 2e-20 | 1 | 60 | 1 | 60 | Myocyte-specific enhancer factor 2B |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Probable transcription factor involved in seed development. {ECO:0000269|PubMed:29853599}. | |||||
| UniProt | Probable transcription factor involved in seed development (PubMed:21447172, Ref.1, PubMed:29853599). Plays a role in seed morphogenesis by promoting the correct development of endotesta cell layer, which directs the further development of the seed coat, the endosperm, and consequently the embryo (Ref.1, PubMed:29853599). {ECO:0000269|PubMed:21447172, ECO:0000269|PubMed:29853599, ECO:0000269|Ref.1}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_018674452.1 | 2e-37 | PREDICTED: agamous-like MADS-box protein AGL11 isoform X1 | ||||
| Swissprot | A0A217EJJ0 | 1e-36 | AG11S_VITVI; Agamous-like MADS-box protein AGL11 | ||||
| Swissprot | F6I457 | 1e-36 | AG11C_VITVI; Agamous-like MADS-box protein AGL11 | ||||
| TrEMBL | A0A426XLP8 | 3e-36 | A0A426XLP8_ENSVE; Uncharacterized protein | ||||
| TrEMBL | A0A453ED03 | 2e-36 | A0A453ED03_AEGTS; Uncharacterized protein | ||||
| STRING | Traes_3B_87AC5133F.2 | 3e-37 | (Triticum aestivum) | ||||
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT3G58780.3 | 9e-39 | MIKC_MADS family protein | ||||




