PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Bv1_015770_ojha.t2

Organism

Beta vulgaris

Taxonomic ID

161934

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Chenopodiaceae; Betoideae; Beta

Family

WOX

Protein Properties

Length: 137aa MW: 16082.1 Da PI: 10.1449

Description

WOX family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Bv1_015770_ojha.t2	genome	TBVR	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Homeobox	44.6	2.4e-14	3	46	19	57
HHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS Homeobox 19 Fek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57 ++ r+p+a+++e+++++l +++ ++V++WFqN++a+e++ Bv1_015770_ojha.t2 3 YRGgMRTPNAQQIEQITEQLskygKIEGKNVFYWFQNHKARERQ 46 565589************************************97 PP
2	Wus_type_Homeobox	88.5	6.9e-29	2	48	19	65
Wus_type_Homeobox 19 lyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqkq 65 ly+ G+rtPn+++i++it++L++yGkie+kNVfyWFQN+kaRerqkq Bv1_015770_ojha.t2 2 LYRGGMRTPNAQQIEQITEQLSKYGKIEGKNVFYWFQNHKARERQKQ 48 9********************************************97 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS50071	8.956	1	47	IPR001356	Homeobox domain
Pfam	PF00046	5.2E-12	3	46	IPR001356	Homeobox domain
SuperFamily	SSF46689	2.85E-8	8	52	IPR009057	Homeodomain-like
Gene3D	G3DSA:1.10.10.60	6.4E-5	9	46	IPR009057	Homeodomain-like

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0001944	Biological Process	vasculature development
GO:0007165	Biological Process	signal transduction
GO:0010067	Biological Process	procambium histogenesis
GO:0051301	Biological Process	cell division
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 137 aa Download sequence Send to blast
MLYRGGMRTP NAQQIEQITE QLSKYGKIEG KNVFYWFQNH KARERQKQKR TILGLSHNPR 60 TPTAATATAT ATTQLNASTT LTLDTRVEFI DQEEQISPYK RKFRNWTFKS SEEKQKKDYT 120 NEEDKTLELF PLHPEGR

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor which may be involved in developmental processes. {ECO:0000250}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_010688717.1	9e-97	PREDICTED: WUSCHEL-related homeobox 4 isoform X1
Swissprot	Q6X7J9	8e-37	WOX4_ARATH; WUSCHEL-related homeobox 4
TrEMBL	A0A0K9R3U0	9e-60	A0A0K9R3U0_SPIOL; Uncharacterized protein
STRING	XP_010688717.1	3e-96	(Beta vulgaris)

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G46480.1	3e-34	WUSCHEL related homeobox 4

Publications ? help Back to Top
Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Dolzblasz A, et al. Stem Cell Regulation by Arabidopsis WOX Genes. Mol Plant, 2016. 9(7): p. 1028-39 [PMID:27109605] Guo X, et al. Identification of cyst nematode B-type CLE peptides and modulation of the vascular stem cell pathway for feeding cell formation. PLoS Pathog., 2017. 13(2): p. e1006142 [PMID:28158306] Denis E, et al. WOX14 promotes bioactive gibberellin synthesis and vascular cell differentiation in Arabidopsis. Plant J., 2017. 90(3): p. 560-572 [PMID:28218997] Kucukoglu M,Nilsson J,Zheng B,Chaabouni S,Nilsson O WUSCHEL-RELATED HOMEOBOX4 (WOX4)-like genes regulate cambial cell division activity and secondary growth in Populus trees. New Phytol., 2017. 215(2): p. 642-657 [PMID:28609015] Yamaguchi YL, et al. Root-Knot and Cyst Nematodes Activate Procambium-Associated Genes in Arabidopsis Roots. Front Plant Sci, 2017. 8: p. 1195 [PMID:28747918]