![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Bv4_091180_ntuh.t1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Chenopodiaceae; Betoideae; Beta
|
||||||||
| Family | MYB_related | ||||||||
| Protein Properties | Length: 45aa MW: 5212.91 Da PI: 9.4279 | ||||||||
| Description | MYB_related family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Myb_DNA-binding | 39.4 | 1.4e-12 | 14 | 45 | 1 | 32 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHT CS
Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmg 32
rg WT+eEd +l +++q+G+++W++I++ g
Bv4_091180_ntuh.t1 14 RGQWTPEEDNKLSSYIAQHGTRNWRLIPKNAG 45
89**************************9876 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:1.10.10.60 | 2.1E-14 | 5 | 43 | IPR009057 | Homeodomain-like |
| SuperFamily | SSF46689 | 5.96E-10 | 8 | 43 | IPR009057 | Homeodomain-like |
| PROSITE profile | PS51294 | 17.866 | 9 | 45 | IPR017930 | Myb domain |
| Pfam | PF00249 | 1.1E-10 | 14 | 45 | IPR001005 | SANT/Myb domain |
| CDD | cd00167 | 1.32E-6 | 17 | 45 | No hit | No description |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 45 aa Download sequence Send to blast |
MGRIPCCEKE NVKRGQWTPE EDNKLSSYIA QHGTRNWRLI PKNAG |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription factor that binds to the DNA sequence 5'-CCAACC-3'. Regulates directly PME5, UND and GLOX1 (PubMed:21673079). Essential for tapetum development in anthers and microsporogenesis (PubMed:12848824, PubMed:21673079). Regulates the timing of tapetal programmed cell death (PCD) which is critical for pollen development. May act through the activation of UND, encoding an A1 aspartic protease (PubMed:21673079). Required for anther development by regulating tapetum development, callose dissolution and exine formation. Acts upstream of A6 and FAR2/MS2, two genes required for pollen exine formation (PubMed:17727613). Negatively regulates trichome endoreduplication and trichome branching (PubMed:12848824). {ECO:0000269|PubMed:12848824, ECO:0000269|PubMed:17727613, ECO:0000269|PubMed:21673079}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_002533727.2 | 2e-26 | probable amino acid permease 7 | ||||
| Swissprot | Q9XHV0 | 3e-26 | MYB80_ARATH; Transcription factor MYB80 | ||||
| TrEMBL | A0A0A0L7E4 | 2e-26 | A0A0A0L7E4_CUCSA; Uncharacterized protein | ||||
| STRING | XP_002533726.1 | 8e-27 | (Ricinus communis) | ||||
| STRING | Al_scaffold_0008_2049 | 2e-25 | (Arabidopsis lyrata) | ||||
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G56110.1 | 1e-28 | myb domain protein 103 | ||||




