PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Bv5_097950_pegm.t2

Organism

Beta vulgaris

Taxonomic ID

161934

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Chenopodiaceae; Betoideae; Beta

Family

YABBY

Protein Properties

Length: 202aa MW: 22703.6 Da PI: 9.4824

Description

YABBY family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Bv5_097950_pegm.t2	genome	TBVR	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	YABBY	222.3	1.3e-68	13	184	2	170
YABBY 2 dvfssseqvCyvqCnfCntilavsvPstslfkvvtvrCGhCtsllsvnlakas.qllaaeshldeslkeelleelkveeen..lksnveke 89 d+f seq+Cy+qC+ C+t+lavsvPs slfk+vtvrCGhCt+l n + q + + hl +++ + + + + e++ ++ +++ Bv5_097950_pegm.t2 13 DHFPPSEQLCYLQCTRCETVLAVSVPSCSLFKTVTVRCGHCTHLQPANTRSLLvQPPPNQFHLAHNYYSPPTSHYRLGEMAnpSPTYSVTQ 103 78999***************************************999887625567788999999887666666555441155677788 PP YABBY 90 esastsvsseklsenedeevprvppvirPPekrqrvPsaynrfikeeiqrikasnPdishreafsaaaknWahfPkihfgl 170 +a++s + +ls+ ++e+p++p ++rPPekrqrvPsaynrfikeeiqrika+nPdishreafsaaaknWahfP+ihfgl Bv5_097950_pegm.t2 104 PNATSSYMTPTLSRGGSNELPKPPTTNRPPEKRQRVPSAYNRFIKEEIQRIKAENPDISHREAFSAAAKNWAHFPHIHFGL 184 88888889999******************************************************************97 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Pfam	PF04690	1.5E-64	17	184	IPR006780	YABBY protein
CDD	cd01390	1.99E-6	124	174	No hit	No description
SuperFamily	SSF47095	4.97E-9	127	177	IPR009071	High mobility group box domain
Gene3D	G3DSA:1.10.30.10	7.1E-6	131	178	IPR009071	High mobility group box domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0007275	Biological Process	multicellular organism development

Sequence ? help Back to Top
Protein Sequence Length: 202 aa Download sequence Send to blast
MSSSTTTTNL SLDHFPPSEQ LCYLQCTRCE TVLAVSVPSC SLFKTVTVRC GHCTHLQPAN 60 TRSLLVQPPP NQFHLAHNYY SPPTSHYRLG EMANPSPTYS VTQPNATSSY MTPTLSRGGS 120 NELPKPPTTN RPPEKRQRVP SAYNRFIKEE IQRIKAENPD ISHREAFSAA AKNWAHFPHI 180 HFGLMPDQTA KRTSTMRPHH PQ

Functional Description ? help Back to Top
Source	Description
UniProt	Involved in the abaxial cell fate determination during embryogenesis and organogenesis. Regulates the initiation of embryonic shoot apical meristem (SAM) development (PubMed:10323860, PubMed:10331982, PubMed:10457020, PubMed:11812777, PubMed:12417699, PubMed:9878633, Ref.3, Ref.6, PubMed:19837869). Required during flower formation and development, particularly for the patterning of floral organs. Positive regulator of class B (AP3 and PI) activity in whorls 2 and 3. Negative regulator of class B activity in whorl 1 and of SUP activity in whorl 3. Interacts with class A proteins (AP1, AP2 and LUG) to repress class C (AG) activity in whorls 1 and 2. Contributes to the repression of KNOX genes (STM, KNAT1/BP and KNAT2) to avoid ectopic meristems. Binds DNA without sequence specificity. In vitro, can compete and displace the AP1 protein binding to DNA containing CArG box (PubMed:10323860, PubMed:10331982, PubMed:10457020, PubMed:11812777, PubMed:12417699, PubMed:9878633, Ref.3, Ref.6). {ECO:0000269\|PubMed:10323860, ECO:0000269\|PubMed:10331982, ECO:0000269\|PubMed:10457020, ECO:0000269\|PubMed:11812777, ECO:0000269\|PubMed:12417699, ECO:0000269\|PubMed:19837869, ECO:0000269\|PubMed:9878633, ECO:0000269\|Ref.3, ECO:0000269\|Ref.6}.
UniProt	Seems to be associated with phloem cell differentiation. {ECO:0000269\|PubMed:17676337}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_010676177.1	1e-149	PREDICTED: axial regulator YABBY 1 isoform X1
Swissprot	A2X7Q3	1e-63	YAB4_ORYSI; Protein YABBY 4
Swissprot	O22152	9e-64	YAB1_ARATH; Axial regulator YABBY 1
Swissprot	Q6H668	1e-63	YAB4_ORYSJ; Protein YABBY 4
TrEMBL	A0A0K9QY62	1e-112	A0A0K9QY62_SPIOL; Uncharacterized protein
STRING	XP_010676177.1	1e-148	(Beta vulgaris)

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT2G45190.1	7e-66	YABBY family protein

Publications ? help Back to Top
Kikuchi S, et al. Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice. Science, 2003. 301(5631): p. 376-9 [PMID:12869764] Duarte JM, et al. Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546] Lian H,Li X,Liu Z,He Y HYL1 is required for establishment of stamen architecture with four microsporangia in Arabidopsis. J. Exp. Bot., 2013. 64(11): p. 3397-410 [PMID:23918970] Tameshige T, et al. Pattern dynamics in adaxial-abaxial specific gene expression are modulated by a plastid retrograde signal during Arabidopsis thaliana leaf development. PLoS Genet., 2013. 9(7): p. e1003655 [PMID:23935517] Boter M, et al. FILAMENTOUS FLOWER Is a Direct Target of JAZ3 and Modulates Responses to Jasmonate. Plant Cell, 2015. 27(11): p. 3160-74 [PMID:26530088] Yang C,Ma Y,Li J The rice YABBY4 gene regulates plant growth and development through modulating the gibberellin pathway. J. Exp. Bot., 2016. 67(18): p. 5545-5556 [PMID:27578842] Douglas SJ,Li B,Kliebenstein DJ,Nambara E,Riggs CD A novel Filamentous Flower mutant suppresses brevipedicellus developmental defects and modulates glucosinolate and auxin levels. PLoS ONE, 2017. 12(5): p. e0177045 [PMID:28493925] Tanaka W,Toriba T,Hirano HY Three TOB1-related YABBY genes are required to maintain proper function of the spikelet and branch meristems in rice. New Phytol., 2017. 215(2): p. 825-839 [PMID:28556940] Silverblatt-Buser EW,Frick MA,Rabeler C,Kaplinsky NJ Genetic Interactions Between BOB1 and Multiple 26S Proteasome Subunits Suggest a Role for Proteostasis in Regulating Arabidopsis Development. G3 (Bethesda), 2018. 8(4): p. 1379-1390 [PMID:29487187]