![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Bv_023860_wmog.t1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Chenopodiaceae; Betoideae; Beta
|
||||||||
| Family | NF-YC | ||||||||
| Protein Properties | Length: 101aa MW: 11175.9 Da PI: 7.5134 | ||||||||
| Description | NF-YC family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NF-YC | 87.9 | 1.1e-27 | 40 | 101 | 14 | 75 |
NF-YC 14 tdfknhelPlarikkilkadedvkmisaeaPvllskacelfileltlrswlhaeenkrrtlk 75
t +k ++P+arikki+k+dedv+mis e+Pvl+skacelfil++t +++ h+ ++krrtl+
Bv_023860_wmog.t1 40 TSLKALQFPVARIKKIMKSDEDVSMISGEVPVLFSKACELFILDMTQQAYQHTLHCKRRTLQ 101
678999******************************************************97 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SuperFamily | SSF47113 | 7.54E-20 | 38 | 101 | IPR009072 | Histone-fold |
| Gene3D | G3DSA:1.10.20.10 | 7.8E-28 | 42 | 101 | IPR009072 | Histone-fold |
| Pfam | PF00808 | 2.8E-18 | 46 | 101 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0046982 | Molecular Function | protein heterodimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 101 aa Download sequence Send to blast |
MSSSLHADEP FAGVLSPADP SAALSSPTNR FAPFVSMEFT SLKALQFPVA RIKKIMKSDE 60 DVSMISGEVP VLFSKACELF ILDMTQQAYQ HTLHCKRRTL Q |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 5g49_B | 2e-21 | 40 | 101 | 11 | 72 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT C-3 |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. {ECO:0000250}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_015649457.1 | 2e-21 | nuclear transcription factor Y subunit C-4-like | ||||
| Swissprot | Q9ZVL3 | 2e-20 | NFYC3_ARATH; Nuclear transcription factor Y subunit C-3 | ||||
| TrEMBL | A0A0J8AZI7 | 6e-68 | A0A0J8AZI7_BETVU; Uncharacterized protein (Fragment) | ||||
| STRING | EFJ28198 | 2e-21 | (Selaginella moellendorffii) | ||||
| STRING | EFJ29692 | 2e-21 | (Selaginella moellendorffii) | ||||
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G54830.3 | 9e-23 | nuclear factor Y, subunit C3 | ||||




