PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID C.cajan_02001
Common NameKK1_002051
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Cajanus
Family MYB_related
Protein Properties Length: 59aa    MW: 6880.04 Da    PI: 11.3794
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
C.cajan_02001genomeIIPGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding25.33.6e-081361247
                     HHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding 12 lvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     ++ + ++lG+g+W+ I+r   ++Rt+ q+ s+ +ky
    C.cajan_02001  1 FLVGLEKLGKGDWRGISRNYVTTRTPTQVASHAHKY 36
                     566889****************************99 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.4E-9141IPR009057Homeodomain-like
PROSITE profilePS5129413.734141IPR017930Myb domain
CDDcd001673.85E-4137No hitNo description
TIGRFAMsTIGR015572.0E-9138IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.607.1E-6236IPR009057Homeodomain-like
PfamPF002496.5E-6236IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 59 aa     Download sequence    Send to blast
FLVGLEKLGK GDWRGISRNY VTTRTPTQVA SHAHKYFIWL ATMNKKKRRS SLFELVQIT
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
14448KKKRR
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional repressor (PubMed:23888064, PubMed:24806884). Direct regulator of the transcription of peroxidase (Prxs) and reactive oxygen species (ROS)-related genes via the recognition of 5'-ATCACA-3' motif (PubMed:24806884). Binds to 5'-TATCCA-3' motif (TA box) and represses the activity of corresponding promoters (e.g. sugar response genes) (PubMed:25920996). Regulates hypocotyl elongation in response to darkness by enhancing auxin accumulation in a phytochrome-interacting factor (PIF) proteins-dependent manner. Promotes lateral roots formation (PubMed:23888064). Promotes cell expansion during leaves development via the modulation of cell wall-located Prxs (PubMed:24806884). Plays a critical role in developmentally regulated and dark-induced onset of leaf senescence by repressing the transcription of several genes involved in chloroplast function and responses to light and auxin. Promotes responses to auxin, abscisic acid (ABA), and ethylene (PubMed:25920996). {ECO:0000269|PubMed:23888064, ECO:0000269|PubMed:24806884, ECO:0000269|PubMed:25920996}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapC.cajan_02001
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Slightly induced by CdCl(2) (PubMed:16463103). Accumulates in the dark (PubMed:23888064, PubMed:25920996). Diurnal expression pattern with maximal levels in the morning (at protein level). Specifically induced during leaf expansion (PubMed:24806884). Expressed in old and dark-treated leaves (PubMed:25920996). {ECO:0000269|PubMed:16463103, ECO:0000269|PubMed:23888064, ECO:0000269|PubMed:24806884, ECO:0000269|PubMed:25920996}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0977056e-59BT097705.1 Soybean clone JCVI-FLGm-16G4 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007152917.15e-30hypothetical protein PHAVU_004G171200g
RefseqXP_020240004.15e-30transcription factor MYBS3
RefseqXP_027923683.14e-30transcription factor MYBS3-like
SwissprotQ9LVS09e-26KUA1_ARATH; Transcription factor KUA1
TrEMBLA0A151SLV95e-36A0A151SLV9_CAJCA; Uncharacterized protein (Fragment)
STRINGXP_007152917.12e-29(Phaseolus vulgaris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF32133271
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G47390.14e-28MYB_related family protein
Publications ? help Back to Top
  1. Liu C,Wang B,Li Z,Peng Z,Zhang J
    TsNAC1 Is a Key Transcription Factor in Abiotic Stress Resistance and Growth.
    Plant Physiol., 2018. 176(1): p. 742-756
    [PMID:29122985]