PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

C.cajan_05140

Common Name

KK1_005269

Organism

Cajanus cajan

Taxonomic ID

3821

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Cajanus

Family

CAMTA

Protein Properties

Length: 135aa MW: 16189.8 Da PI: 8.4871

Description

CAMTA family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
C.cajan_05140	genome	IIPG	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	CG-1	156.6	5e-49	9	124	3	118
CG-1 3 kekkrwlkneeiaaiLenfekheltlelktrpksgsliLynrkkvryfrkDGyswkkkkdgktvrEdhekLKvggvevlycyYahseenptfqrrc 98 + ++rwl++ ei++i+ n +k+ l+ e++ p+sgsl+L++r +vr+frkDG++w+kkkd +tvrE he LKvg+v+vl+cy ah+een +fqrr+ C.cajan_05140 9 EAEHRWLRPVEICEIFSNRNKFLLAPEPAYMPPSGSLFLFDRMVVRFFRKDGHNWRKKKDARTVREVHETLKVGNVDVLSCYCAHGEENDNFQRRT 104 569******************************************************************************************* PP CG-1 99 ywlLeeelekivlvhylevk 118 yw+L+eel++ivl hyl+vk C.cajan_05140 105 YWMLKEELSHIVLLHYLQVK 124 ***************985 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS51437	70.479	3	129	IPR005559	CG-1 DNA-binding domain
SMART	SM01076	1.3E-59	6	124	IPR005559	CG-1 DNA-binding domain
Pfam	PF03859	1.4E-44	9	122	IPR005559	CG-1 DNA-binding domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 135 aa Download sequence Send to blast
MDIQQIILEA EHRWLRPVEI CEIFSNRNKF LLAPEPAYMP PSGSLFLFDR MVVRFFRKDG 60 HNWRKKKDAR TVREVHETLK VGNVDVLSCY CAHGEENDNF QRRTYWMLKE ELSHIVLLHY 120 LQVKVANHSL NYFLL

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription activator that binds to the DNA consensus sequence 5'-[ACG]CGCG[GTC]-3' (By similarity). Regulates transcriptional activity in response to calcium signals (Probable). Binds calmodulin in a calcium-dependent manner (By similarity). Involved in freezing tolerance in association with CAMTA1 and CAMTA3. Contributes together with CAMTA1 and CAMTA3 to the positive regulation of the cold-induced expression of DREB1A/CBF3, DREB1B/CBF1 and DREB1C/CBF2 (PubMed:23581962). Involved together with CAMTA3 and CAMTA4 in the positive regulation of a general stress response (PubMed:25039701). Involved in tolerance to aluminum. Binds to the promoter of ALMT1 transporter and contributes to the positive regulation of aluminum-induced expression of ALMT1 (PubMed:25627216). {ECO:0000250\|UniProtKB:Q8GSA7, ECO:0000269\|PubMed:23581962, ECO:0000269\|PubMed:25039701, ECO:0000269\|PubMed:25627216, ECO:0000305\|PubMed:11925432}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	C.cajan_05140

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: By salt, wounding, abscisic acid, H(2)O(2) and salicylic acid (PubMed:12218065). Induced by aluminum (PubMed:25627216). {ECO:0000269\|PubMed:12218065, ECO:0000269\|PubMed:25627216}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_020210201.1	5e-90	calmodulin-binding transcription activator 2
Swissprot	Q6NPP4	3e-58	CMTA2_ARATH; Calmodulin-binding transcription activator 2
TrEMBL	A0A151U086	6e-97	A0A151U086_CAJCA; Calmodulin-binding transcription activator 2
STRING	evm.model.supercontig_213.9	3e-63	(Carica papaya)
STRING	Pavir.Ib02991.1.p	2e-63	(Panicum virgatum)
STRING	XP_010025463.1	6e-63	(Eucalyptus grandis)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF14241	18	19

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G64220.2	1e-60	Calmodulin-binding transcription activator protein with CG-1 and Ankyrin domains

Publications ? help Back to Top
Benn G, et al. A key general stress response motif is regulated non-uniformly by CAMTA transcription factors. Plant J., 2014. 80(1): p. 82-92 [PMID:25039701] Kidokoro S, et al. Different Cold-Signaling Pathways Function in the Responses to Rapid and Gradual Decreases in Temperature. Plant Cell, 2017. 29(4): p. 760-774 [PMID:28351986]