![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | C.cajan_08024 | ||||||||
| Common Name | KK1_008267 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Cajanus
|
||||||||
| Family | MYB_related | ||||||||
| Protein Properties | Length: 57aa MW: 6488.57 Da PI: 10.4332 | ||||||||
| Description | MYB_related family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Myb_DNA-binding | 35.7 | 2e-11 | 10 | 39 | 1 | 30 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHH CS
Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIart 30
+++WT+eE++ l+ +v ++G g Wk+I +
C.cajan_08024 10 KNKWTKEEEKALIAGVMKHGEGFWKKILQD 39
689************************986 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:1.10.10.60 | 1.2E-12 | 4 | 55 | IPR009057 | Homeodomain-like |
| PROSITE profile | PS50090 | 6.795 | 5 | 55 | IPR017877 | Myb-like domain |
| SuperFamily | SSF46689 | 6.53E-11 | 8 | 55 | IPR009057 | Homeodomain-like |
| Pfam | PF00249 | 1.8E-9 | 10 | 38 | IPR001005 | SANT/Myb domain |
| CDD | cd11660 | 1.71E-12 | 12 | 55 | No hit | No description |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 57 aa Download sequence Send to blast |
MATSKQKIAK NKWTKEEEKA LIAGVMKHGE GFWKKILQDP EFSDVLSSRS NVNIKVI |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Binds preferentially double-stranded telomeric repeats, but may also bind to the single telomeric strand. {ECO:0000250}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | C.cajan_08024 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_012469639.1 | 2e-14 | PREDICTED: telomere repeat-binding factor 2-like isoform X2 | ||||
| Refseq | XP_016680428.1 | 2e-14 | PREDICTED: telomere repeat-binding factor 2-like | ||||
| Refseq | XP_016697329.1 | 2e-14 | PREDICTED: telomere repeat-binding factor 2-like | ||||
| Refseq | XP_016706224.1 | 2e-14 | PREDICTED: telomere repeat-binding factor 2-like isoform X2 | ||||
| Refseq | XP_017624388.1 | 2e-14 | PREDICTED: telomere repeat-binding factor 2-like isoform X2 | ||||
| Refseq | XP_017628203.1 | 2e-14 | PREDICTED: telomere repeat-binding factor 2-like | ||||
| Refseq | XP_017628204.1 | 2e-14 | PREDICTED: telomere repeat-binding factor 2-like | ||||
| Refseq | XP_022775106.1 | 2e-14 | telomere repeat-binding factor 2-like isoform X2 | ||||
| Swissprot | Q8W119 | 1e-14 | SMH4_MAIZE; Single myb histone 4 | ||||
| TrEMBL | A0A151U8C5 | 6e-33 | A0A151U8C5_CAJCA; Uncharacterized protein | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF3228 | 29 | 58 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G17520.1 | 1e-16 | MYB_related family protein | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




