![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | C.cajan_08356 | ||||||||
| Common Name | KK1_008603, KK1_008604 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Cajanus
|
||||||||
| Family | WRKY | ||||||||
| Protein Properties | Length: 66aa MW: 7935.92 Da PI: 8.0735 | ||||||||
| Description | WRKY family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | WRKY | 59.9 | 4.9e-19 | 9 | 47 | 21 | 59 |
-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
WRKY 21 prsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59
rsYYrCt+ +C+vkk+ver aedp++v++tYeg+H h+
C.cajan_08356 9 CRSYYRCTQDNCRVKKRVERLAEDPRMVITTYEGRHAHS 47
7*************************************7 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Pfam | PF03106 | 4.3E-13 | 9 | 46 | IPR003657 | WRKY domain |
| SuperFamily | SSF118290 | 8.89E-15 | 9 | 48 | IPR003657 | WRKY domain |
| Gene3D | G3DSA:2.20.25.80 | 2.7E-16 | 9 | 48 | IPR003657 | WRKY domain |
| SMART | SM00774 | 3.1E-9 | 10 | 48 | IPR003657 | WRKY domain |
| PROSITE profile | PS50811 | 16.432 | 10 | 49 | IPR003657 | WRKY domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 66 aa Download sequence Send to blast |
MMRVWVHACR SYYRCTQDNC RVKKRVERLA EDPRMVITTY EGRHAHSPSN ELEDSQSPSE 60 LSNFFW |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | C.cajan_08356 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AP015035 | 2e-68 | AP015035.1 Vigna angularis var. angularis DNA, chromosome 2, almost complete sequence, cultivar: Shumari. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_020213067.1 | 3e-35 | probable WRKY transcription factor 13 isoform X1 | ||||
| Refseq | XP_020213068.1 | 3e-35 | probable WRKY transcription factor 13 isoform X2 | ||||
| Swissprot | Q9SVB7 | 5e-25 | WRK13_ARATH; Probable WRKY transcription factor 13 | ||||
| TrEMBL | A0A151TQU1 | 6e-43 | A0A151TQU1_CAJCA; Putative WRKY transcription factor 13 | ||||
| STRING | GLYMA04G39621.1 | 2e-32 | (Glycine max) | ||||
| STRING | GLYMA06G15260.1 | 2e-32 | (Glycine max) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF4079 | 33 | 61 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT4G39410.1 | 2e-27 | WRKY DNA-binding protein 13 | ||||




